Lus10041558 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27080 83 / 4e-20 TOM20-3 translocase of outer membrane 20 kDa subunit 3 (.1)
AT5G40930 73 / 2e-16 TOM20-4 translocase of outer membrane 20-4 (.1)
AT1G27390 72 / 4e-16 TOM20-2 translocase outer membrane 20-2 (.1)
AT3G27070 70 / 3e-15 TOM20-1 translocase outer membrane 20-1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012532 130 / 2e-35 AT3G01910 616 / 0.0 sulfite oxidase (.1.2.3)
Lus10035211 112 / 6e-31 AT3G27080 210 / 1e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10032045 110 / 2e-30 AT3G27080 211 / 2e-69 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10011363 69 / 2e-14 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10006419 68 / 2e-14 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10008026 47 / 1e-06 AT5G36930 204 / 1e-54 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G330200 96 / 7e-25 AT1G27390 215 / 3e-71 translocase outer membrane 20-2 (.1)
Potri.001G054900 84 / 3e-20 AT1G27390 230 / 4e-77 translocase outer membrane 20-2 (.1)
Potri.003G173400 78 / 3e-18 AT3G27080 208 / 2e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20
Representative CDS sequence
>Lus10041558 pacid=23146753 polypeptide=Lus10041558 locus=Lus10041558.g ID=Lus10041558.BGIv1.0 annot-version=v1.0
ATGAGTTTCGCCGCCCGCTTTGTCAAAATTGGAATGTTCGAATCACTCATACTTATAAAGAAGGCAATCGAATTGTTGATCTTCTCACGCCCGCAAAACC
GCCGAGGCTGCCTATGCGAAGAACCCTCTCGACGCCGAGGGCAGACGATAAATCCCAAAAAGCATGACACGATTTGGTGCTTGGGCAATGCTCATCATAC
ATCTTATGCGTTCTTAACCCCTGATGAGAAGGAAGCAGATACGTATTTCAAGAAAGCAACTGTCTACTTTCAGCAAGCTGTTAATGAGGATCCAAACAAT
GAGCTATACGTCAAGTCTCTAGAAGTGACTGCTAAGTCAGTTCACCCTCCACAAGTGGCTATGGACATGGATGATGATGACCAGTGGATGGAAGCCATGT
GCAAGACCACGATGACAGTCATATCCCACACGTTTTACACCAGTATCTCATTCAGCTCAAACGATTTCCGGACTGCTCGCGTCTCCAAAAACTGA
AA sequence
>Lus10041558 pacid=23146753 polypeptide=Lus10041558 locus=Lus10041558.g ID=Lus10041558.BGIv1.0 annot-version=v1.0
MSFAARFVKIGMFESLILIKKAIELLIFSRPQNRRGCLCEEPSRRRGQTINPKKHDTIWCLGNAHHTSYAFLTPDEKEADTYFKKATVYFQQAVNEDPNN
ELYVKSLEVTAKSVHPPQVAMDMDDDDQWMEAMCKTTMTVISHTFYTSISFSSNDFRTARVSKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10041558 0 1
Lus10000363 4.2 1.0000
AT2G25737 Sulfite exporter TauE/SafE fam... Lus10022134 5.5 1.0000
AT3G10340 PAL4 phenylalanine ammonia-lyase 4 ... Lus10001405 5.5 1.0000
Lus10003285 7.3 1.0000
AT4G30880 Bifunctional inhibitor/lipid-t... Lus10019770 7.5 1.0000
Lus10004996 8.5 1.0000
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10015284 8.9 0.9536
AT4G22285 Ubiquitin C-terminal hydrolase... Lus10027745 9.2 1.0000
AT5G06570 alpha/beta-Hydrolases superfam... Lus10015988 9.6 0.9444
AT1G61330 FBD, F-box and Leucine Rich Re... Lus10006726 10.2 1.0000

Lus10041558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.