Lus10041559 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69550 90 / 2e-20 disease resistance protein (TIR-NBS-LRR class) (.1)
AT3G25510 86 / 3e-19 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT3G44480 86 / 4e-19 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G44670 84 / 2e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT3G44630 75 / 2e-15 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3)
AT4G19050 75 / 3e-15 NB-ARC domain-containing disease resistance protein (.1)
AT5G44510 74 / 4e-15 TAO1 target of AVRB operation1 (.1)
AT5G45050 74 / 6e-15 WRKY ATWRKY16, TTR1 TOLERANT TO TOBACCO RINGSPOT NEPOVIRUS 1, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
AT3G04220 72 / 2e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT3G44400 72 / 2e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001038 311 / 1e-107 AT1G69550 112 / 2e-27 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10008026 229 / 1e-70 AT5G36930 204 / 1e-54 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10037406 203 / 7e-60 AT5G36930 395 / 5e-116 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10020238 194 / 1e-56 AT1G69550 391 / 7e-117 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10035674 192 / 6e-56 AT5G36930 410 / 1e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10001788 181 / 1e-52 AT1G69550 142 / 2e-34 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10020237 171 / 7e-50 AT1G69550 99 / 3e-21 disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10004115 167 / 2e-47 AT5G27970 689 / 0.0 ARM repeat superfamily protein (.1.2)
Lus10000945 164 / 4e-47 AT1G69550 112 / 3e-25 disease resistance protein (TIR-NBS-LRR class) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G030700 75 / 2e-15 AT1G69550 602 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.005G030318 70 / 1e-13 AT1G69550 673 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.004G088500 69 / 3e-13 AT1G69550 647 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.013G097000 67 / 9e-13 AT5G17680 571 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G070700 67 / 1e-12 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.005G031101 66 / 2e-12 AT5G17680 557 / 8e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G068300 66 / 3e-12 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.013G098000 64 / 1e-11 AT5G17680 575 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.005G031899 63 / 3e-11 AT1G69550 469 / 6e-141 disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.011G012750 62 / 4e-11 AT5G36930 195 / 3e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10041559 pacid=23146804 polypeptide=Lus10041559 locus=Lus10041559.g ID=Lus10041559.BGIv1.0 annot-version=v1.0
ATGAGGGCCTGCAGGTCAGTCATGAGACTGTCTGATGTATCGGTCCTCGAGAACCTGGAGACGCTTGATGTCAGTTGGTGCGTACAGTTGGTCGAGGTCA
CAGGGCTCGAGAGGCTGAAATCGTTGCGAACCTTAGTAATGAAGGCCTGCAAGTCGGTCATGAGGCTACCTGATGTATCTGGCCTCGAGAACTTGGAGGT
GCTTGATGTTAGCAGGTGCGCGCTTCTGGTCGAGGTCACAGGTGTTGGCAGATTGGGATCGTTGGAAGAGTTGAATCTGTCTGGATGTTGGTCGATTGGG
GAGCTTCTAGACGTATCCGGTTTGAAGAATTTGGATGCTTTAGATGTAAGTGACTGCATAGAGTTGGTTAAGGTCACATGTTTAGAGAATTTGGGAATGT
TAACCAAGTTAAACATGTTTGGTTGCAAGTCTTTAAGGGAGTTACCAGATATGTCTAGTTTGAAGAACCTAAGGGATTTGAATCTGAAGGGATGCTCGCA
GGTGAAGACAGTGAAGGGGCTTGAGGGATTGGAAAATCTATGGGAGGTGGAAATGGGGAAAAGGTTAAAAGCTAAGGTTTGCTTGAAATTGGCTGCATCG
AGTGCGATACTTGCACGAACGGTTCGTAGGGTCCTCAAGCAACGGAAGGATGTGAAAGAGATGAAAAGACTATTAGGATTGCGATAA
AA sequence
>Lus10041559 pacid=23146804 polypeptide=Lus10041559 locus=Lus10041559.g ID=Lus10041559.BGIv1.0 annot-version=v1.0
MRACRSVMRLSDVSVLENLETLDVSWCVQLVEVTGLERLKSLRTLVMKACKSVMRLPDVSGLENLEVLDVSRCALLVEVTGVGRLGSLEELNLSGCWSIG
ELLDVSGLKNLDALDVSDCIELVKVTCLENLGMLTKLNMFGCKSLRELPDMSSLKNLRDLNLKGCSQVKTVKGLEGLENLWEVEMGKRLKAKVCLKLAAS
SAILARTVRRVLKQRKDVKEMKRLLGLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69550 disease resistance protein (TI... Lus10041559 0 1
AT5G13800 CRN1, PPH Co-regulated with NYE1, pheoph... Lus10005320 3.3 0.6555
AT1G08580 unknown protein Lus10000388 6.8 0.6511
AT1G18010 Major facilitator superfamily ... Lus10009413 14.0 0.6001
AT1G24420 HXXXD-type acyl-transferase fa... Lus10025521 14.5 0.5992
Lus10025786 15.6 0.5785
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10013919 17.1 0.5892
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013920 18.7 0.5830
AT5G20810 SAUR-like auxin-responsive pro... Lus10034888 19.7 0.5684
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10014126 20.0 0.5830
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10015241 21.2 0.5830

Lus10041559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.