Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01910 119 / 3e-35 AT-SO, ATSO, SOX sulfite oxidase (.1.2.3) AT1G37130 47 / 2e-07 NIA2-1, CHL3, B29, NR2, NIA2, ATNR2 CHLORATE RESISTANT 3, ARABIDOPSIS NITRATE REDUCTASE 2, nitrate reductase 2 (.1) AT1G77760 42 / 6e-06 GNR1, NIA1 nitrate reductase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035213 [exp] 143 / 4e-43 AT3G01910 615 / 0.0 sulfite oxidase (.1.2.3) Lus10032048 [exp] 142 / 1e-42 AT3G01910 620 / 0.0 sulfite oxidase (.1.2.3) Lus10012532 [exp] 146 / 2e-42 AT3G01910 616 / 0.0 sulfite oxidase (.1.2.3) Lus10038977 [exp] 46 / 3e-07 AT1G77760 1397 / 0.0 nitrate reductase 1 (.1) Lus10027270 [exp] 45 / 7e-07 AT1G77760 1380 / 0.0 nitrate reductase 1 (.1) Lus10035402 [exp] 42 / 1e-05 AT1G77760 1277 / 0.0 nitrate reductase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G330900 [exp] 135 / 7e-40 AT3G01910 686 / 0.0 sulfite oxidase (.1.2.3) Potri.005G172400 [exp] 42 / 1e-05 AT1G37130 1400 / 0.0 CHLORATE RESISTANT 3, ARABIDOPSIS NITRATE REDUCTASE 2, nitrate reductase 2 (.1) Potri.002G088600 [exp] 40 / 3e-05 AT1G77760 1394 / 0.0 nitrate reductase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [flax] [poplar] E-set PF03404 [flax] [poplar] Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Representative CDS sequence Show only first row Show all	>Lus10041561 pacid=23146960 polypeptide=Lus10041561 locus=Lus10041561.g ID=Lus10041561.BGIv1.0 annot-version=v1.0 ATGGAAGCTAGAAGGTTCCAGAAGGAAGGTATCCCTTATGTATCAGATGATGAGAAGAGTGACAAATGGGGATGGGTACTTTTTGAAGCTGTAGTGGATG TCCCTCGTAGCACAGAGATTGTGGCAAAAGCAGTGGATTCAGCAGCAAATGTGCAACCTGAAAGCATTCAAGAAATCTGGAACCTGAGAGGGGTACTGAA CACATCGTGGCACCGGGTTCAAATTCGAGTTGGCCACTCGAGTTTGTAA
AA sequence Show only first row Show all	>Lus10041561 pacid=23146960 polypeptide=Lus10041561 locus=Lus10041561.g ID=Lus10041561.BGIv1.0 annot-version=v1.0 MEARRFQKEGIPYVSDDEKSDKWGWVLFEAVVDVPRSTEIVAKAVDSAANVQPESIQEIWNLRGVLNTSWHRVQIRVGHSSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01910		AT-SO, ATSO, SO...	sulfite oxidase (.1.2.3)		Lus10041561 [exp]	0	1
AT3G01910		AT-SO, ATSO, SO...	sulfite oxidase (.1.2.3)		Lus10041560 [exp]	1.0	0.8772
AT1G29530			unknown protein		Lus10015254 [exp]	1.4	0.8735
AT2G34450			HMG-box (high mobility group) ...		Lus10025391 [exp]	4.9	0.7975
AT1G29530			unknown protein		Lus10025373 [exp]	5.7	0.8187
AT4G13200			unknown protein		Lus10022803 [exp]	8.9	0.7938
AT5G64460			Phosphoglycerate mutase family...		Lus10020467 [exp]	8.9	0.7707
AT3G29280			unknown protein		Lus10018197 [exp]	9.2	0.7740
AT4G13200			unknown protein		Lus10011869 [exp]	13.5	0.7947
AT4G29070			Phospholipase A2 family protei...		Lus10030011 [exp]	14.0	0.7576
AT1G56423			unknown protein		Lus10029844 [exp]	14.4	0.8173

Compare expression of checked genes

Lus10041561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.