Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01740 121 / 2e-36 Mitochondrial ribosomal protein L37 (.1) AT5G14290 108 / 3e-31 Mitochondrial ribosomal protein L37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022331 [exp] 189 / 2e-63 AT5G14290 142 / 6e-45 Mitochondrial ribosomal protein L37 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G335600 [exp] 135 / 7e-42 AT3G01740 140 / 3e-44 Mitochondrial ribosomal protein L37 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08561 [flax] [poplar] Ribosomal_L37 Mitochondrial ribosomal protein L37
Representative CDS sequence Show only first row Show all	>Lus10041583 pacid=23146949 polypeptide=Lus10041583 locus=Lus10041583.g ID=Lus10041583.BGIv1.0 annot-version=v1.0 ATGGCAATGAACCATGTAAGGTCCTTGAGAGGTGTCGTCCTTTGTAAAGAAGTAGTTAGAGTGCGGACTTTTGCAGCCGGTGCTAAAGCGAAGAAGGGTT CTAAGGGTGGGGCGGCTGCAGATGCCCCGAAAGTTTCAAGTCTTAGTAAGGAAGTGAAGTCTTCTACATGTGTTGGTGCCAATATTCTAAAGGATGGCAC TGACCCAAAAGTCTTGGCGGATTCTGATTACCCTGAATGGCTGTGGCATCTTCTTGATAAACGTCCGGCATTGAGTGAACTGAGGAGGAAAGACAAACAT TCACTGTCGTATGAAGATCTGAAACGCTATTTCAAGCTGGACAGACGGGCAGGCATTAAGGAAAACAACTCTACTAAGGCCAAGAATTGA
AA sequence Show only first row Show all	>Lus10041583 pacid=23146949 polypeptide=Lus10041583 locus=Lus10041583.g ID=Lus10041583.BGIv1.0 annot-version=v1.0 MAMNHVRSLRGVVLCKEVVRVRTFAAGAKAKKGSKGGAAADAPKVSSLSKEVKSSTCVGANILKDGTDPKVLADSDYPEWLWHLLDKRPALSELRRKDKH SLSYEDLKRYFKLDRRAGIKENNSTKAKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14290			Mitochondrial ribosomal protei...		Lus10041583 [exp]	0	1
AT3G25940			TFIIB zinc-binding protein (.1...		Lus10015458 [exp]	1.0	0.9400
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Lus10036987 [exp]	1.4	0.9364
AT1G77250			RING/FYVE/PHD-type zinc finger...		Lus10028655 [exp]	2.0	0.9145
AT1G48160			signal recognition particle 19...		Lus10011152 [exp]	3.0	0.9193
AT3G54170		ATFIP37	FKBP12 interacting protein 37 ...		Lus10027681 [exp]	3.2	0.9127
AT1G54650			Methyltransferase family prote...		Lus10005515 [exp]	3.5	0.9119
AT4G14420			HR-like lesion-inducing protei...		Lus10041149 [exp]	5.1	0.8983
AT1G77750			Ribosomal protein S13/S18 fami...		Lus10035785 [exp]	7.3	0.8887
AT3G23390			Zinc-binding ribosomal protein...		Lus10040983 [exp]	7.7	0.9031
AT4G24940		ATSAE1A, AT-SAE...	SUMO-activating enzyme 1A (.1)		Lus10008977 [exp]	10.2	0.8961

Compare expression of checked genes

Lus10041583 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.