Lus10041584 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20510 179 / 4e-54 OPCL1 OPC-8:0 CoA ligase1 (.1.2)
AT5G63380 176 / 5e-53 AMP-dependent synthetase and ligase family protein (.1)
AT4G05160 164 / 3e-48 AMP-dependent synthetase and ligase family protein (.1)
AT1G20480 157 / 7e-46 AMP-dependent synthetase and ligase family protein (.1)
AT5G38120 156 / 2e-45 4CL8 AMP-dependent synthetase and ligase family protein (.1)
AT4G19010 156 / 2e-45 AMP-dependent synthetase and ligase family protein (.1)
AT1G20500 155 / 4e-45 AMP-dependent synthetase and ligase family protein (.1)
AT3G21240 135 / 1e-37 AT4CL2, 4CL2 4-coumarate:CoA ligase 2 (.1)
AT1G65060 130 / 5e-36 4CL3 4-coumarate:CoA ligase 3 (.1.2)
AT3G21230 127 / 8e-35 4CL5 4-coumarate:CoA ligase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002791 174 / 6e-52 AT5G63380 688 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10036994 172 / 2e-51 AT5G63380 516 / 4e-179 AMP-dependent synthetase and ligase family protein (.1)
Lus10015998 166 / 7e-49 AT1G20510 833 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10012280 167 / 2e-48 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10015999 164 / 3e-48 AT1G20510 692 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10022336 145 / 1e-45 AT1G20510 95 / 5e-24 OPC-8:0 CoA ligase1 (.1.2)
Lus10021431 151 / 2e-43 AT4G05160 803 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10016630 149 / 2e-43 AT4G19010 532 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10016135 149 / 6e-43 AT4G05160 791 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G033600 190 / 4e-58 AT5G63380 598 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.012G094800 177 / 3e-53 AT5G63380 657 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.015G092300 176 / 6e-53 AT5G63380 594 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.012G094900 175 / 2e-52 AT5G63380 604 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.012G095000 174 / 3e-52 AT5G63380 615 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.002G012800 167 / 2e-49 AT1G20510 769 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.010G230200 167 / 3e-49 AT1G20510 478 / 7e-164 OPC-8:0 CoA ligase1 (.1.2)
Potri.005G248500 166 / 3e-49 AT1G20510 795 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.008G031500 166 / 3e-49 AT1G20510 466 / 3e-159 OPC-8:0 CoA ligase1 (.1.2)
Potri.010G057000 158 / 4e-46 AT5G63380 530 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0378 ANL PF00501 AMP-binding AMP-binding enzyme
Representative CDS sequence
>Lus10041584 pacid=23147029 polypeptide=Lus10041584 locus=Lus10041584.g ID=Lus10041584.BGIv1.0 annot-version=v1.0
ATGGCTCTTATTTTCTGGGCCCAAATTCAGATAGGACGGGCTCTTGTTGCGTATGGGCCGAAAGCTTCGGAAGCTCTGCCTCCTGGGAAACAGGGTGAGC
TATGGATCAGAGGGCCAACCATAATGAAAGGCAAGAAAGCTCCTGAAGGGTTCCTCTATGTAGTGGATCGGATAAAAGAACTCATTAAGTACAAAGGATA
TCAGGTTGCCCCTGCAGAACTTGAGCAATTGCTGCAGTCCCATCTGGGAATACCTGACGCAGCCGTCATCCCGTATCCGGATGAGGAGGCAGGACAGGTG
CCATTTGCATTTGTGGTGAGGGGTGCAGGGAGCAGCAGCCTTGATGCAGGATCAGTAATGGAGTTCGTAGCAAAACAGGTTGCGCCTTACAAGAAGATAA
GGAGGGTGGCGTTTGTGAGTTCAATACCTAAAAGCCCTGCTGGTAAAATTCTGAGGAAGGACTTGAAGAAGATGCTGCCAGCAACTCCCAAGCCTAGATT
GTAG
AA sequence
>Lus10041584 pacid=23147029 polypeptide=Lus10041584 locus=Lus10041584.g ID=Lus10041584.BGIv1.0 annot-version=v1.0
MALIFWAQIQIGRALVAYGPKASEALPPGKQGELWIRGPTIMKGKKAPEGFLYVVDRIKELIKYKGYQVAPAELEQLLQSHLGIPDAAVIPYPDEEAGQV
PFAFVVRGAGSSSLDAGSVMEFVAKQVAPYKKIRRVAFVSSIPKSPAGKILRKDLKKMLPATPKPRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G63380 AMP-dependent synthetase and l... Lus10041584 0 1
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Lus10013395 6.0 0.8149
AT3G24420 alpha/beta-Hydrolases superfam... Lus10017735 12.1 0.8278
AT4G18770 MYB ATMYB98 myb domain protein 98 (.1) Lus10042111 16.9 0.8124
AT5G23940 PEL3, DCR, EMB3... PERMEABLE LEAVES3, EMBRYO DEFE... Lus10039255 18.2 0.8089
Lus10030338 21.8 0.6819
AT2G30900 TBL43 TRICHOME BIREFRINGENCE-LIKE 43... Lus10007367 24.0 0.8053
AT4G25830 Uncharacterised protein family... Lus10019999 29.5 0.7939
AT4G13150 unknown protein Lus10025925 30.3 0.7975
Lus10042024 30.3 0.7948
Lus10038154 35.4 0.7882

Lus10041584 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.