Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49740 123 / 9e-35 PLC-like phosphodiesterases superfamily protein (.1) AT4G36945 120 / 2e-33 PLC-like phosphodiesterases superfamily protein (.1) AT3G19310 119 / 5e-33 PLC-like phosphodiesterases superfamily protein (.1) AT5G67130 115 / 1e-31 PLC-like phosphodiesterases superfamily protein (.1) AT1G13680 108 / 3e-29 PLC-like phosphodiesterases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000092 [exp] 182 / 8e-60 AT4G36945 188 / 2e-58 PLC-like phosphodiesterases superfamily protein (.1) Lus10019339 [exp] 176 / 3e-54 AT4G36945 462 / 1e-161 PLC-like phosphodiesterases superfamily protein (.1) Lus10019843 [exp] 135 / 9e-39 AT1G49740 524 / 0.0 PLC-like phosphodiesterases superfamily protein (.1) Lus10014072 [exp] 134 / 2e-38 AT1G49740 522 / 0.0 PLC-like phosphodiesterases superfamily protein (.1) Lus10012600 [exp] 121 / 5e-34 AT1G13680 440 / 5e-155 PLC-like phosphodiesterases superfamily protein (.1) Lus10009368 [exp] 122 / 7e-34 AT5G67130 580 / 0.0 PLC-like phosphodiesterases superfamily protein (.1) Lus10035130 [exp] 115 / 8e-32 AT1G13680 437 / 7e-154 PLC-like phosphodiesterases superfamily protein (.1) Lus10031973 [exp] 114 / 3e-31 AT1G13680 435 / 1e-153 PLC-like phosphodiesterases superfamily protein (.1) Lus10012665 [exp] 102 / 5e-28 AT1G49740 273 / 4e-92 PLC-like phosphodiesterases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G139400 [exp] 152 / 2e-45 AT4G36945 505 / 4e-179 PLC-like phosphodiesterases superfamily protein (.1) Potri.007G045200 [exp] 143 / 5e-42 AT4G36945 520 / 0.0 PLC-like phosphodiesterases superfamily protein (.1) Potri.004G140200 [exp] 135 / 3e-39 AT1G49740 548 / 0.0 PLC-like phosphodiesterases superfamily protein (.1) Potri.017G098900 [exp] 120 / 6e-34 AT1G13680 450 / 3e-159 PLC-like phosphodiesterases superfamily protein (.1) Potri.005G140100 [exp] 119 / 1e-32 AT5G67130 572 / 0.0 PLC-like phosphodiesterases superfamily protein (.1) Potri.011G144900 [exp] 118 / 1e-32 AT1G13680 462 / 2e-163 PLC-like phosphodiesterases superfamily protein (.1) Potri.007G045700 [exp] 118 / 2e-32 AT5G67130 591 / 0.0 PLC-like phosphodiesterases superfamily protein (.1) Potri.004G117500 [exp] 114 / 2e-31 AT1G13680 447 / 8e-158 PLC-like phosphodiesterases superfamily protein (.1) Potri.009G100332 [exp] 83 / 4e-20 AT1G49740 341 / 9e-118 PLC-like phosphodiesterases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041594 pacid=23146924 polypeptide=Lus10041594 locus=Lus10041594.g ID=Lus10041594.BGIv1.0 annot-version=v1.0 ATGCCAAAGAATGGTGGAGATTGGCCTACAGTGGATGACATGGTGAAAAAGAATCAACGGCTTTTGGTCTTCACCTCCAAAGCCGAGAAAGAGGCTTCTG AGGGGTTTGCATATACATGGAGATATGTATTGGAAACTCAGTATGGAGACGACGGGCTGAAACCTGATTCATGCAAGAACCGAAACGAATCACCTCCTCT CACCATAACTACAATATCGTTGATTCTGGAAAACTTCTTCCCAACTAATCCAAACAACTCTCGAGTCTGCATGGAGAACTCACTTCCACTGGAAGAAGCA ACTAAATCTACTGCACCATTCCATTCATTGTTGGTTGGAGATCCATCCTGTACGCCAAATCTACTGTTTACGGAGAAATGA
AA sequence Show only first row Show all	>Lus10041594 pacid=23146924 polypeptide=Lus10041594 locus=Lus10041594.g ID=Lus10041594.BGIv1.0 annot-version=v1.0 MPKNGGDWPTVDDMVKKNQRLLVFTSKAEKEASEGFAYTWRYVLETQYGDDGLKPDSCKNRNESPPLTITTISLILENFFPTNPNNSRVCMENSLPLEEA TKSTAPFHSLLVGDPSCTPNLLFTEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G49740			PLC-like phosphodiesterases su...		Lus10041594 [exp]	0	1
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10009003 [exp]	2.4	0.9305
					Lus10020194 [exp]	9.2	0.9101
AT3G49680		ATBCAT-3 ,BCAT3	branched-chain aminotransferas...		Lus10007246 [exp]	10.4	0.8993
					Lus10014195 [exp]	11.8	0.9069
AT2G16460			Protein of unknown function (D...		Lus10041812 [exp]	12.6	0.9287
AT5G52170	HD	HDG7	homeodomain GLABROUS 7 (.1)		Lus10035095 [exp]	16.9	0.9008
					Lus10021894 [exp]	17.1	0.8830
AT5G03840		TFL-1, TFL1	TERMINAL FLOWER 1, PEBP (phosp...		Lus10017052 [exp]	17.9	0.7811
AT1G09080		BIP3	binding protein 3, Heat shock ...		Lus10013055 [exp]	18.3	0.9050
AT1G65480		FT	FLOWERING LOCUS T, PEBP (phosp...		Lus10013532 [exp]	19.0	0.8859

Compare expression of checked genes

Lus10041594 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.