Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50210 176 / 2e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49630 154 / 6e-46 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G49620 150 / 4e-44 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 64 / 6e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20400 63 / 7e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G49390 61 / 6e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G13610 59 / 2e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G80340 59 / 3e-10 ATGA3OX2, GA4H ARABIDOPSIS THALIANA GIBBERELLIN-3-OXIDASE 2, gibberellin 3-oxidase 2 (.1) AT4G25310 58 / 4e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 58 / 5e-10 ATSRG1, SRG1 senescence-related gene 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006259 [exp] 317 / 1e-109 AT3G50210 386 / 5e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10011476 [exp] 66 / 1e-12 AT1G15550 412 / 1e-143 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10012963 [exp] 60 / 1e-10 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10027807 [exp] 60 / 1e-10 AT5G05600 330 / 1e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10034964 [exp] 60 / 2e-10 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10005037 [exp] 59 / 2e-10 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10021002 [exp] 59 / 3e-10 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10040112 [exp] 58 / 5e-10 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1) Lus10023850 [exp] 57 / 5e-10 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G047100 [exp] 200 / 1e-63 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.001G355100 [exp] 68 / 2e-13 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.003G057400 [exp] 68 / 2e-13 AT1G15550 451 / 2e-159 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.001G176600 [exp] 67 / 3e-13 AT1G15550 452 / 1e-159 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.018G086800 [exp] 65 / 2e-12 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 63 / 1e-11 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 62 / 2e-11 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G231500 [exp] 61 / 5e-11 AT2G36690 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G086900 [exp] 61 / 6e-11 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.006G101200 [exp] 61 / 6e-11 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10041597 pacid=23146717 polypeptide=Lus10041597 locus=Lus10041597.g ID=Lus10041597.BGIv1.0 annot-version=v1.0 ATGCAAGGAATTGCTTTGGCATTGGGCGGATCAGCATCTGAATTTGAAGGTGATATAGCTGGAGAGCCTTTCTGGGTGCTGCGCATCATTGGTTACCCTG GTCTTATAGCAGATGATCATTACAAATCTGAACATGATGTTGGATGGTTAAGGCTGAATCACTGTTTCCTTTGTGACCAAACAATTAAAGTGGAGCTCAT ACCGACTATGGTGAGGAATCTATCTGGCGAGTGGATATCTGCTCCACCGATACCCGGTACATTCATATGCAACATCGGGGACATGTTGAAGATATGGAGT AATGGTATCTATGACTCAACTGTTCATCGAGTTGTCAATAACAACACCAAATATCGCGTCTGTGTTGCTTATTTCTACGAGGTCAGTGACTTATCACATG CATTCCAATCAATGCATGACTTGGCTGCACGAATGATGTTCGCCAATCTCATACCCTTTTCTTTTTCGCATGGTTGTTTGCAGACAAATTTCAATGCGAC AGTTGAACCCGTCGATTTTTGCATCAAGAAGAGTGGGGGACCAAGGAGGTTGGGAAGAGCTGTGTATGGAGAACATTTGGTTGCCAAAGTTCAAACAAAC TTCGTCTGA
AA sequence Show only first row Show all	>Lus10041597 pacid=23146717 polypeptide=Lus10041597 locus=Lus10041597.g ID=Lus10041597.BGIv1.0 annot-version=v1.0 MQGIALALGGSASEFEGDIAGEPFWVLRIIGYPGLIADDHYKSEHDVGWLRLNHCFLCDQTIKVELIPTMVRNLSGEWISAPPIPGTFICNIGDMLKIWS NGIYDSTVHRVVNNNTKYRVCVAYFYEVSDLSHAFQSMHDLAARMMFANLIPFSFSHGCLQTNFNATVEPVDFCIKKSGGPRRLGRAVYGEHLVAKVQTN FV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G50210			2-oxoglutarate (2OG) and Fe(II...		Lus10041597 [exp]	0	1
AT1G54140		TAF9, TAFII21	TBP-ASSOCIATED FACTOR 9, TATA ...		Lus10022103 [exp]	1.0	0.8748
AT5G45275			Major facilitator superfamily ...		Lus10033280 [exp]	11.2	0.8593
					Lus10023803 [exp]	11.5	0.8502
					Lus10011613 [exp]	17.1	0.7164
AT3G06440			Galactosyltransferase family p...		Lus10043102 [exp]	19.2	0.8042
AT5G19450		CPK8, CDPK19	calcium-dependent protein kina...		Lus10030134 [exp]	20.2	0.8441
AT5G19450		CPK8, CDPK19	calcium-dependent protein kina...		Lus10009947 [exp]	22.7	0.8215
					Lus10018837 [exp]	22.9	0.8374
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10004652 [exp]	23.9	0.8298
AT1G01320			Tetratricopeptide repeat (TPR)...		Lus10020453 [exp]	27.5	0.7283

Compare expression of checked genes

Lus10041597 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.