Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 89 / 5e-21 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 85 / 4e-20 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72940 85 / 8e-20 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72860 85 / 1e-19 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72930 80 / 5e-19 TIR toll/interleukin-1 receptor-like (.1.2) AT1G17615 83 / 7e-19 Disease resistance protein (TIR-NBS class) (.1) AT1G72910 82 / 7e-19 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72950 80 / 6e-18 Disease resistance protein (TIR-NBS class) (.1) AT4G19510 81 / 7e-18 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G27170 80 / 9e-18 transmembrane receptors;ATP binding (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026845 [exp] 186 / 5e-59 AT5G36930 145 / 8e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041606 [exp] 182 / 2e-57 AT5G36930 140 / 5e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10027920 [exp] 144 / 2e-42 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10012063 [exp] 136 / 4e-40 AT5G36930 124 / 5e-34 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10006928 [exp] 111 / 9e-29 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10006929 [exp] 106 / 1e-28 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10014671 [exp] 102 / 8e-27 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10029921 [exp] 102 / 5e-26 AT5G36930 105 / 7e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10042020 [exp] 99 / 2e-24 AT1G72890 147 / 3e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G069200 [exp] 101 / 4e-25 AT5G17680 590 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.005G004366 [exp] 92 / 6e-24 AT1G72930 114 / 1e-32 toll/interleukin-1 receptor-like (.1.2) Potri.T126306 [exp] 97 / 1e-23 AT3G14470 585 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.013G098100 [exp] 92 / 1e-23 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G097050 [exp] 91 / 3e-23 AT5G36930 158 / 3e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G097000 [exp] 95 / 5e-23 AT5G17680 571 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G019053 [exp] 95 / 6e-23 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G096849 [exp] 90 / 6e-23 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T126506 [exp] 95 / 8e-23 AT3G14470 575 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.012G135700 [exp] 95 / 8e-23 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10041605 pacid=23146947 polypeptide=Lus10041605 locus=Lus10041605.g ID=Lus10041605.BGIv1.0 annot-version=v1.0 ATGAAGGAGGGCATCCCACGTGCCATTGAGCAATCCAAGATGTCCATCGTGGTTCTGTCCAGAGGATACGCTTCCTCGGAATGGTGCTTAGACCAATTGG TGAAGATCATGGACGAGACAGCCAAAGGCCACCACCAAACTTTCCCGATATTTTATCATGTGACTCCCGATGAAGTGTCCGATCATCAGTTATCCGGCTG CTACAAGGATGACTTCGACCGGCACAAGAAGAAATTCAGCTACTACCGAGTGCAGAGCTGGAGTGCTGCACTCACTTCCATTGCCGACATTTCGGGATGG ATTCACCACACTGGCGGATCGGAAGCAGAACTCGTAGAGAAGATAGTGAAGAACATAATATGGATGGAGAGAGAACCAAGTCACAGTTATGACCGTCCTC CGTTTGTTCCTGCTTTCCGGCCGCCGGAGGGTTCATCATCAATTTATGAGCCAGCTGCTGCAGGAAACAAACAACCTTCTTCCTCTACTGTAAGTACAAT TGTATATTATCATATGTATGTATCATAG
AA sequence Show only first row Show all	>Lus10041605 pacid=23146947 polypeptide=Lus10041605 locus=Lus10041605.g ID=Lus10041605.BGIv1.0 annot-version=v1.0 MKEGIPRAIEQSKMSIVVLSRGYASSEWCLDQLVKIMDETAKGHHQTFPIFYHVTPDEVSDHQLSGCYKDDFDRHKKKFSYYRVQSWSAALTSIADISGW IHHTGGSEAELVEKIVKNIIWMEREPSHSYDRPPFVPAFRPPEGSSSIYEPAAAGNKQPSSSTVSTIVYYHMYVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G72940			Toll-Interleukin-Resistance (T...		Lus10041605 [exp]	0	1
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10007102 [exp]	1.0	0.9236
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10035625 [exp]	2.0	0.8595
AT5G42340		PUB15	Plant U-Box 15 (.1)		Lus10012260 [exp]	2.4	0.8015
					Lus10010582 [exp]	3.5	0.8370
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10036959 [exp]	4.0	0.8350
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10019030 [exp]	6.3	0.8220
AT5G06839	bZIP	TGA10, bZIP65	TGACG \(TGA\) motif-binding pr...		Lus10035499 [exp]	11.0	0.7679
AT1G09380			nodulin MtN21 /EamA-like trans...		Lus10031437 [exp]	11.1	0.7228
AT1G14220			Ribonuclease T2 family protein...		Lus10035882 [exp]	11.5	0.7926
AT2G02990		RNS1, ATRNS1	ribonuclease 1 (.1)		Lus10035881 [exp]	13.3	0.7910

Compare expression of checked genes

Lus10041605 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.