Lus10041610 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12390 229 / 6e-77 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
AT5G13850 217 / 3e-72 NACA3 nascent polypeptide-associated complex subunit alpha-like protein 3 (.1)
AT3G49470 209 / 8e-69 NACA2 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
AT4G10480 199 / 3e-65 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1), Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.2)
AT1G33040 189 / 3e-61 NACA5 nascent polypeptide-associated complex subunit alpha-like protein 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024109 249 / 4e-86 AT3G12390 198 / 1e-65 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10026133 231 / 1e-78 AT3G12390 204 / 2e-68 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10008687 218 / 8e-70 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2)
Lus10015579 204 / 8e-67 AT3G49470 260 / 1e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10032927 204 / 8e-67 AT3G49470 260 / 2e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034400 258 / 3e-88 AT3G12390 204 / 5e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.003G190800 254 / 8e-87 AT3G12390 204 / 7e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.006G032000 233 / 1e-78 AT3G12390 215 / 2e-71 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.015G003300 209 / 1e-68 AT3G49470 172 / 4e-54 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Potri.012G006700 199 / 6e-65 AT3G49470 171 / 1e-53 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
CL0214 UBA PF00627 UBA UBA/TS-N domain
Representative CDS sequence
>Lus10041610 pacid=23146676 polypeptide=Lus10041610 locus=Lus10041610.g ID=Lus10041610.BGIv1.0 annot-version=v1.0
ATGACGGCCGAGACTCAGGAGCAGCTACTCGCCTCTCAGCTCGAAGCTCAAAAGCTTCAAGATAAATACATGGTCGTGTGCAACGTAGTTGTGAAATATA
TACTCTGCCTCAGACAACTTGGTGATGCAAGTGGTAGATCAAAACAAACAAGAAGTGAAAAGAAGAGCCGCAAAGCAATGTTGAAGCTGGGAATGAAACC
CATGACTGGTGTCAGTCGGGTTACCGTCAAAAAGAGCAAGAACATATTGTTTGTGATCTCAAAGCCTGATGTCTTCAAGAGCCCGACATCAGACACATAC
ATAGTCTTTGGAGAGGCTAAGATTGAAGACATAAGCTCACAGCTACAGTCTCAAGCAGCAGAGCAGTTCAGGGCTCCTGATCTGAGTCATTTGAGTGCAA
AACCTGAGACTTCTGCCATGGCTCAGGATGACGATGATGATGTAGATGAAACTGGAGTGGAGCCCAAGGACATTGAGTTGGTGATGACACAGGCAGGAGT
CACAAGGGCCAAAGCTGTGAGGTCTCTCAAGGCGGCTGATGGAGACATTGTTTCTGCCATCATGGAGCTCACCACCTGA
AA sequence
>Lus10041610 pacid=23146676 polypeptide=Lus10041610 locus=Lus10041610.g ID=Lus10041610.BGIv1.0 annot-version=v1.0
MTAETQEQLLASQLEAQKLQDKYMVVCNVVVKYILCLRQLGDASGRSKQTRSEKKSRKAMLKLGMKPMTGVSRVTVKKSKNILFVISKPDVFKSPTSDTY
IVFGEAKIEDISSQLQSQAAEQFRAPDLSHLSAKPETSAMAQDDDDDVDETGVEPKDIELVMTQAGVTRAKAVRSLKAADGDIVSAIMELTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12390 Nascent polypeptide-associated... Lus10041610 0 1
AT2G19730 Ribosomal L28e protein family ... Lus10037609 2.8 0.8878
AT3G52570 alpha/beta-Hydrolases superfam... Lus10016992 3.7 0.8836
AT5G02610 Ribosomal L29 family protein ... Lus10025292 4.6 0.8671
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10031551 7.1 0.8485
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10006914 8.0 0.8612
AT2G05840 PAA2 20S proteasome subunit PAA2 (.... Lus10039932 9.9 0.7690
AT3G10950 Zinc-binding ribosomal protein... Lus10006414 10.4 0.8399
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Lus10016432 10.9 0.8360
AT3G16780 Ribosomal protein L19e family ... Lus10023388 11.7 0.8076
AT1G60080 3'-5'-exoribonuclease family p... Lus10021789 14.4 0.8079

Lus10041610 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.