Lus10041616 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024104 111 / 2e-31 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10041616 pacid=23146887 polypeptide=Lus10041616 locus=Lus10041616.g ID=Lus10041616.BGIv1.0 annot-version=v1.0
ATGGGAGCCATGATCTACTTCTCTTTTCTTATTACCATCCTAGCCTTTCTTACCCTATCCGCTCAAGCTAGAACTTTCCCTGCTTGTTCACGATCCATCC
ATCCATATATTCCAGGTGAGGGAAAAGCTGTGGTGATAATCTACGGGAGGAGCTCATCAAGTCTACACCTCCACCTAACGCCCATCCTCTCAGCTGCTAT
CAATAATAAAGATATTATGGTGGAAGCACCAGCCAGGCCGAAACCTAAACCACCATCTCCCAAGCCGGCTTCCCCTATATCTGAGCTTACTTCATCATCT
ACGTCGTCCAGTACTGATCATGATGATGATGGTGGTATTATGACGATGGTGACCGGTACGGCGGGTACTGTGGAAGGAAGAAAGGTGTTAACACCTCCGC
CGTCTCCAAAGCCAGCCTCCCCTACCCATTACGTTGCTCCTCATCATCATCATGAGCGCTCTCCTCCTGCGGAATCCGGCGGATCGTATTACTATTCCTC
ATCATCATAA
AA sequence
>Lus10041616 pacid=23146887 polypeptide=Lus10041616 locus=Lus10041616.g ID=Lus10041616.BGIv1.0 annot-version=v1.0
MGAMIYFSFLITILAFLTLSAQARTFPACSRSIHPYIPGEGKAVVIIYGRSSSSLHLHLTPILSAAINNKDIMVEAPARPKPKPPSPKPASPISELTSSS
TSSSTDHDDDGGIMTMVTGTAGTVEGRKVLTPPPSPKPASPTHYVAPHHHHERSPPAESGGSYYYSSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041616 0 1
AT5G27690 Heavy metal transport/detoxifi... Lus10033469 3.6 0.9222
AT1G49330 hydroxyproline-rich glycoprote... Lus10015036 7.4 0.8521
Lus10033727 7.7 0.8972
Lus10025141 8.8 0.9061
AT4G18550 AtDSEL Arabidopsis thaliana DAD1-like... Lus10017668 8.9 0.8992
AT5G63710 Leucine-rich repeat protein ki... Lus10035959 9.8 0.9074
AT2G45010 PLAC8 family protein (.1.2) Lus10028184 10.0 0.8848
AT5G06800 GARP myb-like HTH transcriptional r... Lus10023816 11.6 0.8999
AT2G17700 STY8 serine/threonine/tyrosine kina... Lus10004153 13.2 0.9043
AT5G39020 Malectin/receptor-like protein... Lus10025545 13.3 0.9052

Lus10041616 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.