Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08230 39 / 4e-05 glycine-rich protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024100 [exp] 53 / 1e-10 AT4G08230 93 / 1e-25 glycine-rich protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G174700 [exp] 42 / 2e-06 AT4G08230 97 / 1e-27 glycine-rich protein (.1.2) Potri.002G086600 [exp] 41 / 2e-06 AT4G08230 98 / 5e-28 glycine-rich protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10961 [flax] [poplar] SelK_SelG Selenoprotein SelK_SelG
Representative CDS sequence Show only first row Show all	>Lus10041619 pacid=23146638 polypeptide=Lus10041619 locus=Lus10041619.g ID=Lus10041619.BGIv1.0 annot-version=v1.0 ATGTTATCGATGGATAAGTCAGATGCTTACAAGAAAGGAAGTGGTTCTAGCAAGAAATGGGACGGTGGATCTGGAGGACCTGGAAGTGGACCGTATGGTG GAGGCCGTCCAGGCGGTCCACGCAGAGGAGGACTCGACAATGTTCGACAACTTAATCACAACTCCTTACCTGCTTGTGGTTCCTGCTGCGGCTAA
AA sequence Show only first row Show all	>Lus10041619 pacid=23146638 polypeptide=Lus10041619 locus=Lus10041619.g ID=Lus10041619.BGIv1.0 annot-version=v1.0 MLSMDKSDAYKKGSGSSKKWDGGSGGPGSGPYGGGRPGGPRRGGLDNVRQLNHNSLPACGSCCG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G08230			glycine-rich protein (.1.2)		Lus10041619 [exp]	0	1
AT3G60540			Preprotein translocase Sec, Se...		Lus10010009 [exp]	1.0	0.9432
AT3G01170			Ribosomal protein L34e superfa...		Lus10030686 [exp]	1.4	0.9225
AT3G53490			unknown protein		Lus10003989 [exp]	3.0	0.9209
AT4G13530			unknown protein		Lus10030342 [exp]	3.5	0.9137
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Lus10001237 [exp]	3.9	0.9134
AT1G15270			Translation machinery associat...		Lus10037543 [exp]	7.9	0.9034
AT1G36310			S-adenosyl-L-methionine-depend...		Lus10023545 [exp]	8.4	0.8977
AT5G39950		ATTRXH2, ATTRX2...	Arabidopsis thioredoxin h2, th...		Lus10030666 [exp]	9.2	0.8951
AT1G36980			unknown protein		Lus10035779 [exp]	11.0	0.8894
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10002228 [exp]	13.0	0.8939

Compare expression of checked genes

Lus10041619 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.