Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43150 52 / 4e-10 unknown protein AT1G48330 38 / 9e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024091 [exp] 147 / 2e-46 ND 44 / 3e-05 Lus10002866 [exp] 41 / 1e-05 ND / Lus10004910 [exp] 40 / 2e-05 AT5G43150 45 / 1e-07 unknown protein Lus10012234 [exp] 40 / 3e-05 ND / Lus10010543 [exp] 39 / 3e-05 AT5G43150 45 / 1e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G037400 [exp] 117 / 1e-35 AT5G43150 56 / 1e-11 unknown protein Potri.003G187500 [exp] 114 / 9e-35 AT5G43150 51 / 8e-10 unknown protein Potri.002G119700 [exp] 58 / 1e-12 AT5G43150 58 / 1e-12 unknown protein Potri.018G131900 [exp] 58 / 4e-12 ND / Potri.010G004000 [exp] 49 / 3e-09 AT1G48330 86 / 8e-24 unknown protein Potri.006G070200 [exp] 49 / 2e-08 ND / Potri.010G088200 [exp] 42 / 1e-06 AT5G43150 40 / 8e-06 unknown protein Potri.008G152200 [exp] 43 / 3e-06 AT5G43150 41 / 9e-06 unknown protein Potri.013G037800 [exp] 40 / 7e-06 AT5G43150 39 / 2e-05 unknown protein Potri.006G103800 [exp] 37 / 0.0002 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041628 pacid=23146653 polypeptide=Lus10041628 locus=Lus10041628.g ID=Lus10041628.BGIv1.0 annot-version=v1.0 ATGGAGTTCTGGGATAAGGTTATCTTCCCTGTCCGCCGCGCCTGGACCGCCGTTTCTGCTCGCGTCAAGTCCCGCAAACACGGTAGTGGCAGCATTCTCA TCCTTCACAACGACGTTCAAACTTGCGGCTACGAGGACGTCCAAGTCATGTGGGAAATGCTGCGCAGGTCCGAAACGGAGATGATCGGCGGCGGCAATCT TCAGAAGCGTAATCGCCGGTCGTTCTGGAGGGTCTTCGTCTGGTCTACTCACAGGAGTAGTGCATCATCTGCAGCAGCTTCACCTCTTTCTGCAGATATG ATTTGA
AA sequence Show only first row Show all	>Lus10041628 pacid=23146653 polypeptide=Lus10041628 locus=Lus10041628.g ID=Lus10041628.BGIv1.0 annot-version=v1.0 MEFWDKVIFPVRRAWTAVSARVKSRKHGSGSILILHNDVQTCGYEDVQVMWEMLRRSETEMIGGGNLQKRNRRSFWRVFVWSTHRSSASSAAASPLSADM I

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G43150			unknown protein		Lus10041628 [exp]	0	1
					Lus10035430 [exp]	1.4	0.8452
AT5G49610			F-box family protein (.1)		Lus10017086 [exp]	2.2	0.8533
					Lus10024091 [exp]	2.8	0.8387
AT2G31820			Ankyrin repeat family protein ...		Lus10027074 [exp]	4.2	0.8410
AT3G23920		BAM1, BMY7, TR-...	BETA-AMYLASE 7, beta-amylase 1...		Lus10004396 [exp]	8.8	0.8138
AT3G05675			BTB/POZ domain-containing prot...		Lus10023030 [exp]	11.5	0.6983
AT1G70000	MYB		myb-like transcription factor ...		Lus10010733 [exp]	13.0	0.8359
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Lus10033625 [exp]	15.7	0.8091
AT5G49610			F-box family protein (.1)		Lus10037802 [exp]	19.7	0.7638
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10033754 [exp]	23.7	0.8143

Compare expression of checked genes

Lus10041628 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.