Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79660 97 / 6e-28 unknown protein AT1G16170 87 / 5e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024088 [exp] 162 / 7e-54 AT1G79660 119 / 6e-37 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G038750 [exp] 100 / 5e-29 AT1G16170 78 / 2e-20 unknown protein Potri.001G038200 [exp] 99 / 9e-29 AT1G16170 59 / 1e-12 unknown protein Potri.003G186400 [exp] 97 / 6e-28 AT1G16170 92 / 5e-26 unknown protein Potri.001G040300 [exp] 96 / 2e-27 AT1G16170 94 / 7e-27 unknown protein Potri.001G039700 [exp] 80 / 4e-21 AT1G16170 76 / 9e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041631 pacid=23146915 polypeptide=Lus10041631 locus=Lus10041631.g ID=Lus10041631.BGIv1.0 annot-version=v1.0 ATGGTTCTTGACGGCTTATCTTCTCCGCGTAGAGTATCAACATCGATCAGGAAAGGAACCCCCAAGGACGAGCTTGGGAGCTTGTCGACGGTCCTTAACA GACACAGGTTCCTACTGACAGCTTTGGTTCTTTTGGCCTTCCTATGCACCATCTACCTTTACTTCGCCATTACACTAGGGGCGGCGGCAGCTACATGTTC AGGAATGTCAGGGAAAGAAAAGGCCTTGTGCCATTTGGAGCATGCAAAGACCTCCATGACTTCTGGAAAACTCAAATTTTTCTAA
AA sequence Show only first row Show all	>Lus10041631 pacid=23146915 polypeptide=Lus10041631 locus=Lus10041631.g ID=Lus10041631.BGIv1.0 annot-version=v1.0 MVLDGLSSPRRVSTSIRKGTPKDELGSLSTVLNRHRFLLTALVLLAFLCTIYLYFAITLGAAAATCSGMSGKEKALCHLEHAKTSMTSGKLKFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G79660			unknown protein		Lus10041631 [exp]	0	1
AT4G03420			Protein of unknown function (D...		Lus10031632 [exp]	2.8	0.7382
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Lus10038818 [exp]	6.3	0.7505
AT2G46080			unknown protein		Lus10007920 [exp]	8.8	0.7836
AT1G79660			unknown protein		Lus10024088 [exp]	11.2	0.7995
AT2G36900		ATMEMB11, MEMB1...	membrin 11 (.1.2)		Lus10020302 [exp]	13.1	0.7593
AT3G08890			Protein of unknown function, D...		Lus10012232 [exp]	14.5	0.7928
AT5G47200		AtRABD2b, AtRab...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10004361 [exp]	18.7	0.7205
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10012832 [exp]	18.7	0.7339
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Lus10016977 [exp]	22.7	0.7292
AT5G19860			Protein of unknown function, D...		Lus10039187 [exp]	24.5	0.7237

Compare expression of checked genes

Lus10041631 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.