Lus10041663 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019165 132 / 5e-40 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10041663 pacid=23146994 polypeptide=Lus10041663 locus=Lus10041663.g ID=Lus10041663.BGIv1.0 annot-version=v1.0
ATGACGACGACGACCAACACAAAAGTGTCCTCTGCAACCATAGTCTTCCTCGTTACGCTCATCCTTCTCCAAACCGTCTCTGCCAGGAGGAACCTGCTCG
ACACAGGATCTCCCCAAACCGGGTATGGCGAAGAGAAGGGCGACGGGAGTAAAAGCGGGGTACAGAGGAGCGAATCCAGGGACTCTGGCTCAGCCAACGG
CGATAGGTCTCCCACTGCCGGTACGGTCCAAATGCCGCCGCCCACTGCGGTGACTAGTGTCTCCTACAATACTGGTGGAGGTTCCAACAACAACAATAAT
TACCAGCCATCGTCTGATGTTCGAGACGACTATTCATCACCTCCTGGAAATTACGGATATGGTAGGGGTGGATCCGGCGGATCGAATACCCAGCCGGAAC
GTCCTCCTAGCGACGGTTACGTGCCTGCAGTAGAAGGCCGAGGAGGCTTTAATTAA
AA sequence
>Lus10041663 pacid=23146994 polypeptide=Lus10041663 locus=Lus10041663.g ID=Lus10041663.BGIv1.0 annot-version=v1.0
MTTTTNTKVSSATIVFLVTLILLQTVSARRNLLDTGSPQTGYGEEKGDGSKSGVQRSESRDSGSANGDRSPTAGTVQMPPPTAVTSVSYNTGGGSNNNNN
YQPSSDVRDDYSSPPGNYGYGRGGSGGSNTQPERPPSDGYVPAVEGRGGFN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041663 0 1
AT1G01490 Heavy metal transport/detoxifi... Lus10027522 1.7 0.9053
Lus10041664 3.7 0.9035
Lus10023082 4.7 0.8606
AT5G62230 ERL1 ERECTA-like 1 (.1.2) Lus10027580 4.9 0.8970
AT1G34670 MYB ATMYB93 myb domain protein 93 (.1) Lus10039771 6.9 0.8704
AT4G12010 Disease resistance protein (TI... Lus10006789 6.9 0.8606
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10018379 9.4 0.8758
Lus10012064 10.9 0.8477
AT5G10770 Eukaryotic aspartyl protease f... Lus10020099 11.0 0.8719
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Lus10020491 12.7 0.8469

Lus10041663 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.