Plant FIBer expression Database

Lus10041670 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80500 145 / 3e-45 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024068
[exp]
159 / 8e-47 AT1G15950 534 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G183400
[exp]
147 / 3e-46 AT1G80500 266 / 1e-93 SNARE-like superfamily protein (.1)
Potri.001G043400
[exp]
147 / 6e-46 AT1G80500 264 / 8e-93 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF04628 Sedlin_N Sedlin, N-terminal conserved region
Representative CDS sequence
>Lus10041670 pacid=23146925 polypeptide=Lus10041670 locus=Lus10041670.g ID=Lus10041670.BGIv1.0 annot-version=v1.0
ATGGCGACCACTGCTTGTTTTATCATCGTCAGCCGGAACGATATCCCCATATACGATGCTGAAGTTGGAACTGCTACTAAAAGAGAGGATGCTGCTCAGT
TGCATCAGTTCGTATTGCATGCAGCCTTGGATATTGTTCAGGATCTAGCTTGGACCACTAGTGCCATGTTCTTGAAGAATATTGACAGGTTCAATGACCT
GGTGGTATCAGTTTATGTCACTGCTGGCTTGATGCTCATACTTGTCTATTCATGTCTTGGAGAAGTACTGTTTTGGACACATCTACCAGTGCATGTCCAC
AACAGTAGAAATCTTCATCAGTTAGAATCAATCGGTTGGTTAGAATATTGTACTCCATCAGCATTTGGGTTTGGTGGCAATGTTGCAGCTGTAGTGAAGT
ATGCAACAAACTCATTGAGGTTCTTTCTTCAAGTAGTGGTTTCTGTGAAGATTGATTTGGGGTATTATGATGAGATCTCAGATCTGTGA
AA sequence
>Lus10041670 pacid=23146925 polypeptide=Lus10041670 locus=Lus10041670.g ID=Lus10041670.BGIv1.0 annot-version=v1.0
MATTACFIIVSRNDIPIYDAEVGTATKREDAAQLHQFVLHAALDIVQDLAWTTSAMFLKNIDRFNDLVVSVYVTAGLMLILVYSCLGEVLFWTHLPVHVH
NSRNLHQLESIGWLEYCTPSAFGFGGNVAAVVKYATNSLRFFLQVVVSVKIDLGYYDEISDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80500 SNARE-like superfamily protein... Lus10041670
[exp]
0 1
AT4G38500 Protein of unknown function (D... Lus10025082
[exp]
4.0 0.7414
AT3G27240 Cytochrome C1 family (.1) Lus10041579
[exp]
8.5 0.6956
AT1G31420 FEI1 FEI 1, Leucine-rich repeat pro... Lus10034739
[exp]
12.0 0.7320
AT5G01650 Tautomerase/MIF superfamily pr... Lus10022681
[exp]
15.1 0.7408
AT5G16660 unknown protein Lus10026866
[exp]
15.8 0.7547
AT3G06145 unknown protein Lus10004420
[exp]
17.1 0.7251
AT2G18245 alpha/beta-Hydrolases superfam... Lus10026001
[exp]
17.1 0.6641
AT1G11840 ATGLX1 glyoxalase I homolog (.1.2.3.4... Lus10000007
[exp]
20.0 0.7203
AT2G20280 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10023164
[exp]
22.6 0.6954
AT3G07880 SCN1 SUPERCENTIPEDE1, Immunoglobuli... Lus10006400
[exp]
25.5 0.7410

Lus10041670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.