Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80920 120 / 2e-35 AtToc12, AtJ8, J8 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) AT5G59610 57 / 3e-10 Chaperone DnaJ-domain superfamily protein (.1.2) AT1G72070 54 / 5e-10 Chaperone DnaJ-domain superfamily protein (.1) AT5G16650 53 / 2e-09 Chaperone DnaJ-domain superfamily protein (.1) AT3G62600 53 / 9e-09 ATERDJ3B DNAJ heat shock family protein (.1) AT2G41000 52 / 9e-09 Chaperone DnaJ-domain superfamily protein (.1.2) AT3G08970 52 / 1e-08 TMS1, ATERDJ3A THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) AT2G33735 48 / 9e-08 Chaperone DnaJ-domain superfamily protein (.1) AT1G79940 50 / 1e-07 ATERDJ2A DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) AT1G77930 49 / 2e-07 Chaperone DnaJ-domain superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024067 [exp] 203 / 6e-68 AT1G80920 130 / 4e-39 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10014352 [exp] 153 / 2e-48 AT1G80920 135 / 2e-41 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10026061 [exp] 145 / 2e-45 AT1G80920 136 / 1e-41 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10016510 [exp] 69 / 2e-14 AT5G59610 252 / 2e-83 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10040777 [exp] 68 / 3e-14 AT5G59610 246 / 6e-81 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10003380 [exp] 61 / 2e-11 AT3G08970 615 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10002852 [exp] 60 / 4e-11 AT3G08970 600 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10031336 [exp] 55 / 3e-09 AT3G17830 459 / 5e-158 Molecular chaperone Hsp40/DnaJ family protein (.1) Lus10039293 [exp] 54 / 7e-09 AT1G79940 1086 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G183700 [exp] 148 / 2e-46 AT1G80920 130 / 4e-39 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Potri.001G043100 [exp] 141 / 1e-43 AT1G80920 129 / 2e-38 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Potri.001G072700 [exp] 61 / 1e-11 AT5G59610 254 / 3e-84 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.016G120000 [exp] 59 / 5e-11 AT3G08970 479 / 6e-164 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Potri.014G122600 [exp] 56 / 1e-09 AT3G62600 565 / 0.0 DNAJ heat shock family protein (.1) Potri.019G041400 [exp] 52 / 2e-09 AT5G16650 193 / 5e-65 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G198000 [exp] 51 / 3e-08 AT3G62600 551 / 0.0 DNAJ heat shock family protein (.1) Potri.005G073900 [exp] 49 / 1e-07 AT2G22360 659 / 0.0 DNAJ heat shock family protein (.1) Potri.017G148800 [exp] 49 / 2e-07 AT1G79940 1062 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) Potri.004G072200 [exp] 49 / 2e-07 AT1G79940 1087 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10041671 pacid=23146623 polypeptide=Lus10041671 locus=Lus10041671.g ID=Lus10041671.BGIv1.0 annot-version=v1.0 ATGGCTAGCGCGGCTATGATGATCGGAGGCAGCAGGTGCGGCGGATCTTCCTCGCCGTCCTGGTTTCAGTCGCATAACTGCAAAAACTTCGCAGGTAGGA GGAACTCGTCCTGCAGGACGTTCTGCGTGTCTTCTTCATTGGTGAAGGATCCGTATAAAACCTTGATGATCAAGCCTGGTGCCTCCGAATCCGAGGTCAA GAAAGCCTTCCGCAAACTCGCTCTCCAGTATCATCCGGATGTTTGCAGAGGGAGCAATTGCGGGGTTAAATTCAGTATGATCAATGAAGCGTACAATGTT GTGATGATGAAATTGAGGCAGGAAGCAGCTACGCCGGAGCCGGAACCGGAGCCGGAATATGAACTGTGGGAGGAGTGGATGGGATGGGAAGGAGCAGGGA TTAGGGACTATTCTTCCCATATTAATCCTTACATTTGA
AA sequence Show only first row Show all	>Lus10041671 pacid=23146623 polypeptide=Lus10041671 locus=Lus10041671.g ID=Lus10041671.BGIv1.0 annot-version=v1.0 MASAAMMIGGSRCGGSSSPSWFQSHNCKNFAGRRNSSCRTFCVSSSLVKDPYKTLMIKPGASESEVKKAFRKLALQYHPDVCRGSNCGVKFSMINEAYNV VMMKLRQEAATPEPEPEPEYELWEEWMGWEGAGIRDYSSHINPYI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G80920		AtToc12, AtJ8, ...	translocon at the outer envelo...		Lus10041671 [exp]	0	1
AT1G80920		AtToc12, AtJ8, ...	translocon at the outer envelo...		Lus10024067 [exp]	1.4	0.9387
AT5G02020		SIS	Salt Induced Serine rich, unkn...		Lus10021101 [exp]	1.7	0.9516
AT1G56220			Dormancy/auxin associated fami...		Lus10031488 [exp]	3.3	0.8872
AT4G16130		ATISA1, ARA1	arabinose kinase (.1)		Lus10020178 [exp]	3.9	0.9365
AT1G15740			Leucine-rich repeat family pro...		Lus10025751 [exp]	4.5	0.9317
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Lus10017209 [exp]	4.6	0.9056
AT3G49940	AS2	LBD38	LOB domain-containing protein ...		Lus10011530 [exp]	5.2	0.8548
AT3G06350		EMB3004, MEE32	MATERNAL EFFECT EMBRYO ARREST ...		Lus10004130 [exp]	5.5	0.8780
AT5G19120			Eukaryotic aspartyl protease f...		Lus10021939 [exp]	6.7	0.9283
AT5G24490			30S ribosomal protein, putativ...		Lus10015569 [exp]	7.3	0.9093

Compare expression of checked genes

Lus10041671 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.