Lus10041672 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15900 99 / 3e-28 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G046900 129 / 6e-40 AT1G15900 126 / 1e-38 unknown protein
PFAM info
Representative CDS sequence
>Lus10041672 pacid=23147084 polypeptide=Lus10041672 locus=Lus10041672.g ID=Lus10041672.BGIv1.0 annot-version=v1.0
ATGTCGGATGAAGATCCTTGGGTAGCCAGGGACAAGCTTTACCACTTCCTCTTCTGTTTATCACTTACCCTTTTCTTCTCCCAACTCGCCTCCTCCACTC
GCTACGCTTCTCTTCGTCGCCACTCCATCTGGGTCGGTTCCACCCTTTCCCTCCTCGCCGGCGCCGCCAAAGAGTTCGCCGACCACCTTGGAATCTTCCC
TTCCGCCGGCGCCTCCGCCAAGGACGCTGTTGCTGATCTTATTGGCGTTCTGGTAGCAGCATTCGCACTCTCGATCTGTAGACGCCGTTTTGGATTCGAC
TCAGCTTCGGGTCAGACCCGACGAGTTCTCCCTGTTTAG
AA sequence
>Lus10041672 pacid=23147084 polypeptide=Lus10041672 locus=Lus10041672.g ID=Lus10041672.BGIv1.0 annot-version=v1.0
MSDEDPWVARDKLYHFLFCLSLTLFFSQLASSTRYASLRRHSIWVGSTLSLLAGAAKEFADHLGIFPSAGASAKDAVADLIGVLVAAFALSICRRRFGFD
SASGQTRRVLPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15900 unknown protein Lus10041672 0 1
AT4G10070 KH domain-containing protein (... Lus10002947 10.6 0.8438
AT5G59740 UDP-N-acetylglucosamine (UAA) ... Lus10040866 14.5 0.8165
AT3G43590 zinc knuckle (CCHC-type) famil... Lus10013378 18.8 0.8128
AT2G28070 ABCG3 ATP-binding cassette G3, ABC-2... Lus10041333 26.2 0.8067
AT1G74960 ATKAS2, KAS2, F... ARABIDOPSIS BETA-KETOACYL-ACP ... Lus10034886 35.1 0.7975
AT5G36740 Acyl-CoA N-acyltransferase wit... Lus10022053 40.9 0.8058
AT3G53320 unknown protein Lus10023170 43.0 0.8035
AT2G27100 C2H2ZnF SE C2H2 zinc-finger protein SERRA... Lus10026766 45.5 0.7961
AT2G33620 AT-hook AT hook motif DNA-binding fami... Lus10011067 57.6 0.8010
AT5G14610 DEAD box RNA helicase family p... Lus10001272 73.8 0.7839

Lus10041672 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.