Lus10041700 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39880 190 / 4e-62 Ribosomal protein L23/L15e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024048 312 / 1e-110 AT4G39880 188 / 1e-61 Ribosomal protein L23/L15e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G075500 223 / 2e-75 AT4G39880 191 / 1e-62 Ribosomal protein L23/L15e family protein (.1)
Potri.007G093100 116 / 8e-34 AT4G39880 90 / 1e-23 Ribosomal protein L23/L15e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00276 Ribosomal_L23 Ribosomal protein L23
Representative CDS sequence
>Lus10041700 pacid=23146851 polypeptide=Lus10041700 locus=Lus10041700.g ID=Lus10041700.BGIv1.0 annot-version=v1.0
ATGGGGAGCAGGCTAGGGAGAAGAGTGATTCACTTCGCAAACCTTCCGATCAAGCTCCTAATGCCCAAGACCTACAACAACATCGACGAAATCGCCCTCA
AGACCATCCCATCCGCTTCCAAGATCGAAATCAAGCGCGTGCTCGAGTCCCTCTACGGCTTCGACGTCGACAAGGTCCGCACTCTCAACATGGAAGGCAA
GAAGAAGAAGCGCGGCGGACTTCTCTTCGCCAAGCCTGACTACAAAAAGGCCTACGTCACCCTCAAGACGCCGCTATCTCTGTCTCCCGATTTGTTCCCC
CTCAAGGTCGTCGAGCAGGAGAAGGAGAGGATGAACAAGCAGCAGAGGTCCGGCGTCGTGGAGGACGGCGGAGATAAAAAGCACTGGCTCGAAGATAGGA
GAGGGGAGAAGGACCGGAACGAGATCCAAGGAAGTAGAGGAGGAAGTAGCGGATACAAGGGGCGACGTGGTGATGCTGCGGCGGAGAAGCTCAAGTTCCC
TTGGAGCAGCATGAGGACAGCAAAGTAG
AA sequence
>Lus10041700 pacid=23146851 polypeptide=Lus10041700 locus=Lus10041700.g ID=Lus10041700.BGIv1.0 annot-version=v1.0
MGSRLGRRVIHFANLPIKLLMPKTYNNIDEIALKTIPSASKIEIKRVLESLYGFDVDKVRTLNMEGKKKKRGGLLFAKPDYKKAYVTLKTPLSLSPDLFP
LKVVEQEKERMNKQQRSGVVEDGGDKKHWLEDRRGEKDRNEIQGSRGGSSGYKGRRGDAAAEKLKFPWSSMRTAK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39880 Ribosomal protein L23/L15e fam... Lus10041700 0 1
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10010429 2.6 0.9720
AT5G35530 Ribosomal protein S3 family pr... Lus10030502 2.8 0.9700
AT5G13780 Acyl-CoA N-acyltransferases (N... Lus10016378 2.8 0.9641
AT5G44500 Small nuclear ribonucleoprotei... Lus10013108 4.5 0.9669
AT3G57490 Ribosomal protein S5 family pr... Lus10027358 5.7 0.9673
AT1G10580 Transducin/WD40 repeat-like su... Lus10030620 5.7 0.9585
AT3G57150 ATNAP57, ATCBF5... homologue of NAP57 (.1) Lus10023565 5.9 0.9642
AT2G47790 Transducin/WD40 repeat-like su... Lus10001029 6.9 0.9558
AT3G11400 ATEIF3G1, EIF3G... eukaryotic translation initiat... Lus10012833 7.1 0.9597
AT3G05590 RPL18 ribosomal protein L18 (.1) Lus10015198 8.4 0.9666

Lus10041700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.