Lus10041705 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39910 683 / 0 ATUBP3 ubiquitin-specific protease 3 (.1)
AT2G22310 682 / 0 ATUBP4 ubiquitin-specific protease 4 (.1.2)
AT4G24560 135 / 1e-34 UBP16 ubiquitin-specific protease 16 (.1)
AT5G57990 132 / 1e-33 UBP23 ubiquitin-specific protease 23 (.1)
AT3G14400 130 / 5e-33 UBP25 ubiquitin-specific protease 25 (.1)
AT5G65450 128 / 2e-32 UBP17 ubiquitin-specific protease 17 (.1)
AT4G31670 127 / 6e-32 UBP18 ubiquitin-specific protease 18 (.1)
AT1G17110 120 / 1e-29 UBP15 ubiquitin-specific protease 15 (.1.2)
AT2G24640 119 / 1e-29 UBP19 ubiquitin-specific protease 19 (.1.2)
AT4G17895 113 / 3e-27 UBP20 ubiquitin-specific protease 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024043 767 / 0 AT4G39910 682 / 0.0 ubiquitin-specific protease 3 (.1)
Lus10014333 714 / 0 AT4G39910 643 / 0.0 ubiquitin-specific protease 3 (.1)
Lus10026041 540 / 0 AT4G39910 481 / 8e-172 ubiquitin-specific protease 3 (.1)
Lus10036607 138 / 2e-35 AT5G57990 536 / 5e-178 ubiquitin-specific protease 23 (.1)
Lus10035825 137 / 2e-35 AT5G57990 537 / 3e-178 ubiquitin-specific protease 23 (.1)
Lus10009273 136 / 6e-35 AT4G24560 585 / 0.0 ubiquitin-specific protease 16 (.1)
Lus10032623 126 / 2e-31 AT5G46740 366 / 1e-110 ubiquitin-specific protease 21 (.1)
Lus10043127 125 / 3e-31 AT5G46740 362 / 2e-115 ubiquitin-specific protease 21 (.1)
Lus10020116 123 / 1e-30 AT2G24640 686 / 0.0 ubiquitin-specific protease 19 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G093600 733 / 0 AT4G39910 679 / 0.0 ubiquitin-specific protease 3 (.1)
Potri.005G074900 732 / 0 AT4G39910 678 / 0.0 ubiquitin-specific protease 3 (.1)
Potri.018G107500 145 / 6e-38 AT5G57990 580 / 0.0 ubiquitin-specific protease 23 (.1)
Potri.006G185200 144 / 9e-38 AT5G57990 620 / 0.0 ubiquitin-specific protease 23 (.1)
Potri.005G156900 130 / 9e-33 AT4G24560 639 / 0.0 ubiquitin-specific protease 16 (.1)
Potri.002G104800 129 / 2e-32 AT4G24560 551 / 7e-179 ubiquitin-specific protease 16 (.1)
Potri.003G092400 129 / 2e-32 AT4G17895 358 / 2e-112 ubiquitin-specific protease 20 (.1)
Potri.011G112800 127 / 5e-32 AT3G14400 690 / 0.0 ubiquitin-specific protease 25 (.1)
Potri.001G378900 125 / 4e-31 AT1G17110 848 / 0.0 ubiquitin-specific protease 15 (.1.2)
Potri.001G394600 124 / 5e-31 AT3G14400 653 / 0.0 ubiquitin-specific protease 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Representative CDS sequence
>Lus10041705 pacid=23146770 polypeptide=Lus10041705 locus=Lus10041705.g ID=Lus10041705.BGIv1.0 annot-version=v1.0
ATGGGTGCGGCTGGTTCAAAACTAGAGAAGGCTCTCGGCGATCAGTTCCCCGAAGGCGAACGATACTTCGGCCTTGAGAATTTCGGCAACACTTGCTACT
GCAACAGCGTCTTGCAGGCTCTATACTTTTGTGTACCATTCCGGGAACAATTGCTTGAATACTACGCAAATAACAAATCCATTGCAGATGCGGAAGAGAA
TCTATTAACATGTTTGGCTGACTTATTCACACAGATAAGCTCACAGAAGAAGAAAACTGGTGTCATTGCACCCAAGCGCTTTGTCCAGCGGCTGAAAAAA
CAAAATGAGCTTTTCCGTAGCTATATGCACCAGGATGCTCATGAATTTTTGAATTTCTTGCTTAATGAACTTGTTGACATACTTGAGAAAGAGGCCAAAG
CTGTTAAAATTGATACAGAAACTTCGTCTCCACCTGAAAAGATCGCCAATGGCACAAAGAGTACTCTAGCGAATGGCGTGTCTAAGGAACCTTTAGTTAC
TTGGGTGCACAAGAATTTCCAGGGAATACTTACGAATGAGACCAGGTGTCTGCAGTGTGAAACGGTGACAGCTAGAGATGAGACATTCTTTGATTTGAGC
TTAGATATAGAGCAGAACAGTTCAATAACTAGCTGTCTGAAGAACTTTAGTTCAACAGAGACTCTTAATGCAGAAGATAAATTTTTCTGTGACAAGTGTT
GCAGTTTGCAAGAAGCTCAAAAGAGAATGAAGATAAAGAAGCCTCCCCATATCTTGGTCATCCACCTCAAGAGGTTCAAGTATATCGAGCAGTTGGGCAG
GTACAAGAAGTTATCATACCGGGTAGTGTTCCCCCTTGAACTAAAACTGAGCAATACAATGGAAGATTCAGACATCGAATACTCGCTCTTTGCTGTGGTT
GTACATGTTGGAAGCGGGCCGAACCACGGGCACTACGTCAGTCTTGTGAAAAGCCACAATCACTGGTTGTTCTTCGACGACGAAAATGTGGAGATGATTG
ATGAGTCGGCCGTCCAAACGTTTTTTGGTTCGGCTCAAGAGTACTCGAGTAACACAGATCACGGGTATATCTTGTTCTACGAGAGCATCACTGCTAACAA
GAGCTGA
AA sequence
>Lus10041705 pacid=23146770 polypeptide=Lus10041705 locus=Lus10041705.g ID=Lus10041705.BGIv1.0 annot-version=v1.0
MGAAGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLEYYANNKSIADAEENLLTCLADLFTQISSQKKKTGVIAPKRFVQRLKK
QNELFRSYMHQDAHEFLNFLLNELVDILEKEAKAVKIDTETSSPPEKIANGTKSTLANGVSKEPLVTWVHKNFQGILTNETRCLQCETVTARDETFFDLS
LDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTMEDSDIEYSLFAVV
VHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSAQEYSSNTDHGYILFYESITANKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39910 ATUBP3 ubiquitin-specific protease 3 ... Lus10041705 0 1
AT1G72740 MYB Homeodomain-like/winged-helix ... Lus10030935 2.0 0.8940
AT5G53000 TAP46 2A phosphatase associated prot... Lus10036520 6.7 0.8466
AT5G44090 Calcium-binding EF-hand family... Lus10022907 8.3 0.8623
AT5G28850 Calcium-binding EF-hand family... Lus10021174 8.8 0.8972
AT4G02570 AXR6, ATCUL1 AUXIN RESISTANT 6, cullin 1 (.... Lus10032200 9.6 0.8854
AT2G27285 Coiled-coil domain-containing ... Lus10038787 9.8 0.8550
AT1G78420 RING/U-box superfamily protein... Lus10013709 10.8 0.8414
AT4G10930 unknown protein Lus10023068 10.8 0.8776
AT5G09860 AtTHO1, AtHPR1 nuclear matrix protein-related... Lus10024130 15.1 0.8638
AT1G78420 RING/U-box superfamily protein... Lus10005577 16.2 0.8773

Lus10041705 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.