Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10130 146 / 3e-45 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 135 / 4e-41 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 114 / 8e-33 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT1G29140 81 / 1e-19 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 78 / 1e-18 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 78 / 2e-18 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 45 / 1e-05 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026040 [exp] 237 / 4e-81 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014332 [exp] 233 / 1e-79 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042201 [exp] 140 / 9e-43 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 138 / 5e-42 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10028134 [exp] 85 / 3e-21 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 84 / 8e-21 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 80 / 4e-19 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 79 / 5e-19 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 79 / 8e-19 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G078200 [exp] 179 / 3e-58 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 176 / 2e-57 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 142 / 9e-44 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 137 / 8e-42 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 102 / 5e-28 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 89 / 9e-23 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 53 / 1e-08 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 46 / 2e-06 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 44 / 2e-05 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 42 / 4e-05 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10041707 pacid=23146645 polypeptide=Lus10041707 locus=Lus10041707.g ID=Lus10041707.BGIv1.0 annot-version=v1.0 ATGGCGTCAGTGGATGGATGGTCAACGTTACTCTTGCTTGGCCTACTCTGGGTCATCCTTCCAGCAACCAACGGCAAGTTCATAGGAAAGCCGTTCGTCA TCCGTGGCAGCGTCTACTGCGACACTTGCCGCTGCGGCTTTGAGACCAACAAAACCACTTACATCCCTGGAGCGACGGTGGAGGTGAAGTGCAAAGACAG GGACACCCTGCAGCTGAGGTACAGAGACGAAACGACGACGCGGAGTGACGGCTCGTACGAGATAACGGTGGAAGATGACCACGGTGACCAGATCTGCGAG ACGGTTCTGGTCAGCAGCCCGTTGGGTTACTGCAAAGTGGCGGATCCGGGTAGGTCCCACTCCGAAGTGATATTAACCCGCTCCAATGGCGCCATCTCCA ACCTTCACTTCGCCAACGCGATGGGGTTCCTCAAGGACGAAGCAGAGGATGGATGCGCTGAGCTTGTTCACCACCTCTTGTACGACGACGTTTAG
AA sequence Show only first row Show all	>Lus10041707 pacid=23146645 polypeptide=Lus10041707 locus=Lus10041707.g ID=Lus10041707.BGIv1.0 annot-version=v1.0 MASVDGWSTLLLLGLLWVILPATNGKFIGKPFVIRGSVYCDTCRCGFETNKTTYIPGATVEVKCKDRDTLQLRYRDETTTRSDGSYEITVEDDHGDQICE TVLVSSPLGYCKVADPGRSHSEVILTRSNGAISNLHFANAMGFLKDEAEDGCAELVHHLLYDDV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10041707 [exp]	0	1
AT2G43870			Pectin lyase-like superfamily ...		Lus10022530 [exp]	1.4	0.9927
AT4G37160		SKS15	SKU5 similar 15 (.1)		Lus10019642 [exp]	2.0	0.9911
AT5G54370			Late embryogenesis abundant (L...		Lus10031297 [exp]	2.4	0.9861
AT3G19990			unknown protein		Lus10028680 [exp]	3.0	0.9899
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10011746 [exp]	3.5	0.9885
AT3G20820			Leucine-rich repeat (LRR) fami...		Lus10031377 [exp]	3.9	0.9879
AT5G45580	GARP		Homeodomain-like superfamily p...		Lus10010404 [exp]	5.1	0.9616
AT4G12730		FLA2	FASCICLIN-like arabinogalactan...		Lus10001752 [exp]	6.5	0.9819
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10031855 [exp]	6.7	0.9507
AT3G14470			NB-ARC domain-containing disea...		Lus10002609 [exp]	7.1	0.9793

Compare expression of checked genes

Lus10041707 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.