Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36680 44 / 3e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024025 [exp] 58 / 3e-11 AT4G36680 475 / 1e-167 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G125400 [exp] 46 / 5e-07 AT4G36680 478 / 2e-168 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G028400 [exp] 41 / 2e-05 AT4G36680 477 / 2e-168 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041726 pacid=23146719 polypeptide=Lus10041726 locus=Lus10041726.g ID=Lus10041726.BGIv1.0 annot-version=v1.0 ATGGCTTCTTCACTTCCCCTCCGCCACCTGTCCACCGCCGCAGCCGCCTCCGATGCCGCCGTCGCTACAACTGCAGCTACAGCAGCTTCCTCAATTTCCA TATCCGAGGCGAAATCCAAGCTCCGATCCGAGCACGACCCCGACAAAGCCCTTGAAATCTACTCCTCCGTATCCTCCCACTACTCCTCCCCTGTCTCCTC CCGCTACGCCCAGGACCTCGCCGTCCGTCGCCTCGCCAAAGCCGCCGCTTCTCCGGCATCGAGGCCCTAA
AA sequence Show only first row Show all	>Lus10041726 pacid=23146719 polypeptide=Lus10041726 locus=Lus10041726.g ID=Lus10041726.BGIv1.0 annot-version=v1.0 MASSLPLRHLSTAAAASDAAVATTAATAASSISISEAKSKLRSEHDPDKALEIYSSVSSHYSSPVSSRYAQDLAVRRLAKAAASPASRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36680			Tetratricopeptide repeat (TPR)...		Lus10041726 [exp]	0	1
AT4G27610			unknown protein		Lus10034127 [exp]	28.9	0.5634
AT1G68260			Thioesterase superfamily prote...		Lus10031936 [exp]	55.2	0.5265
AT5G16380			Protein of unknown function, D...		Lus10026841 [exp]	126.7	0.5411
AT3G60750			Transketolase (.1.2)		Lus10007839 [exp]	134.2	0.4891
AT3G47340		AT-ASN1, DIN6, ...	DARK INDUCIBLE 6, ARABIDOPSIS ...		Lus10031870 [exp]	134.3	0.4925
AT5G19630			alpha/beta-Hydrolases superfam...		Lus10004187 [exp]	156.6	0.5030
AT3G03380		DEG7, DEGP7	degradation of periplasmic pro...		Lus10042507 [exp]	164.7	0.5092
AT1G29220			transcriptional regulator fami...		Lus10007288 [exp]	186.9	0.4866
AT3G22830	HSF	AT-HSFA6B	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10000492 [exp]	226.6	0.4739

Compare expression of checked genes

Lus10041726 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.