Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17020 129 / 1e-36 transcription factor-related (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001212 [exp] 169 / 9e-51 AT3G09010 384 / 2e-128 Protein kinase superfamily protein (.1) Lus10012849 [exp] 166 / 1e-50 AT4G17020 711 / 0.0 transcription factor-related (.1.2.3) Lus10002564 [exp] 153 / 2e-49 AT4G17020 174 / 5e-54 transcription factor-related (.1.2.3) Lus10005856 [exp] 67 / 5e-14 AT3G09010 279 / 6e-89 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G041600 [exp] 135 / 7e-39 AT4G17020 758 / 0.0 transcription factor-related (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03849 [flax] [poplar] Tfb2 Transcription factor Tfb2
Representative CDS sequence Show only first row Show all	>Lus10041753 pacid=23147018 polypeptide=Lus10041753 locus=Lus10041753.g ID=Lus10041753.BGIv1.0 annot-version=v1.0 ATGCCTCAAGTAAAGATAATTGCGAAGAACTTCATGGACGTGGGGCCGCCCCCCCCCGCCATGAAACTCGATGTTCTCTACGAGAACTCATTCATCTGCG AAGCCATTCTCAGAGCTTATTTACATTCTTTTGAGATAAGGTCACTCCCGCCTCTGGTGAAGAAGTACGTCATTCAAATGCTATACATAGAAGGCTCCGT GACTGCTAAGTTATTGGAAGAGTGGGTACTTTCCGACGGTTTGACCAAGCACTTGGTCTCCATTGATCGGTTGGTTCAGCTCAGAATCTTAACCGAAGCC GTTGAAAGGTTTGATTCTACTAGACACTGTCATTTTGCATAG
AA sequence Show only first row Show all	>Lus10041753 pacid=23147018 polypeptide=Lus10041753 locus=Lus10041753.g ID=Lus10041753.BGIv1.0 annot-version=v1.0 MPQVKIIAKNFMDVGPPPPAMKLDVLYENSFICEAILRAYLHSFEIRSLPPLVKKYVIQMLYIEGSVTAKLLEEWVLSDGLTKHLVSIDRLVQLRILTEA VERFDSTRHCHFA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17020			transcription factor-related (...		Lus10041753 [exp]	0	1
AT4G02280		ATSUS3, SUS3	sucrose synthase 3 (.1)		Lus10008204 [exp]	12.0	0.6852
AT1G22870			Protein kinase family protein ...		Lus10007901 [exp]	24.8	0.7369
AT4G23980	ARF	ARF9	auxin response factor 9 (.1.2)		Lus10032413 [exp]	31.2	0.7279
AT4G24840			unknown protein		Lus10024203 [exp]	72.8	0.6626
AT1G18880		NRT1.9	nitrate transporter 1.9, Major...		Lus10015351 [exp]	74.5	0.6403
AT5G14740		BETACA2, CA18, ...	CARBONIC ANHYDRASE 18, BETA CA...		Lus10016443 [exp]	78.6	0.6715
AT2G41700		AtABCA1, ABCA1	Arabidopsis thaliana ATP-bindi...		Lus10023157 [exp]	95.1	0.6566
AT5G14940			Major facilitator superfamily ...		Lus10039465 [exp]	109.2	0.6272
AT4G20050		QRT3	QUARTET 3, Pectin lyase-like s...		Lus10036231 [exp]	121.2	0.6378

Compare expression of checked genes

Lus10041753 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.