Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015511 [exp] 100 / 8e-26 AT5G57710 899 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10019984 [exp] 98 / 5e-25 AT5G57710 912 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10023201 [exp] 40 / 0.0001 AT5G57710 404 / 1e-127 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10008902 [exp] 39 / 0.0003 AT5G57710 392 / 3e-124 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G097300 [exp] 46 / 7e-07 AT5G57710 998 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Potri.006G175200 [exp] 43 / 8e-06 AT5G57710 913 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041755 pacid=23146738 polypeptide=Lus10041755 locus=Lus10041755.g ID=Lus10041755.BGIv1.0 annot-version=v1.0 ATGGTCCTCAGGAAGTTGAAGACCCTGGACAAAACCCAGTCTAGGTTGCTGTTTCTTCAACTTTGGACGACTGGAATCATGAGCAACTCTTTTGAGTCAT TGTCATCCTCACCATTGATGAAGAGCTTTCCAACTGTGGTGCCAATTGCTCCATTAAAACAGCTACCTGATAATCCGGATCCTGCCCCGAAAACAAACTT GTGCAGTCAGTGCAGTCAAAACTATGAGCAAGAGCTGACAAAGGATGTGCCCAAGAATCTTGAGAAACCTTCCACGGACGACGTTGAAGCTATACTAATC AGCAGTCTTTGCCTCCTTGGCTGA
AA sequence Show only first row Show all	>Lus10041755 pacid=23146738 polypeptide=Lus10041755 locus=Lus10041755.g ID=Lus10041755.BGIv1.0 annot-version=v1.0 MVLRKLKTLDKTQSRLLFLQLWTTGIMSNSFESLSSSPLMKSFPTVVPIAPLKQLPDNPDPAPKTNLCSQCSQNYEQELTKDVPKNLEKPSTDDVEAILI SSLCLLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041755 [exp]	0	1
AT5G01250			alpha 1,4-glycosyltransferase ...		Lus10035526 [exp]	6.3	0.7854
					Lus10010271 [exp]	7.5	0.7985
					Lus10000890 [exp]	12.3	0.7686
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10041667 [exp]	15.9	0.7916
AT5G39110			RmlC-like cupins superfamily p...		Lus10035293 [exp]	17.5	0.7675
AT2G38870			Serine protease inhibitor, pot...		Lus10024870 [exp]	21.0	0.7962
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10024152 [exp]	22.8	0.7457
					Lus10012132 [exp]	26.7	0.7784
AT3G02645			Plant protein of unknown funct...		Lus10033668 [exp]	32.9	0.7222
AT5G47550			Cystatin/monellin superfamily ...		Lus10027320 [exp]	34.9	0.7829

Compare expression of checked genes

Lus10041755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.