Lus10041756 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18290 346 / 2e-123 EMB2783, APC10 EMBRYO DEFECTIVE 2783, anaphase promoting complex 10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028308 394 / 4e-142 AT2G18290 343 / 4e-122 EMBRYO DEFECTIVE 2783, anaphase promoting complex 10 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G121700 350 / 4e-125 AT2G18290 318 / 2e-112 EMBRYO DEFECTIVE 2783, anaphase promoting complex 10 (.1)
Potri.007G023500 343 / 4e-122 AT2G18290 314 / 9e-111 EMBRYO DEFECTIVE 2783, anaphase promoting complex 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0202 GBD PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Representative CDS sequence
>Lus10041756 pacid=23146724 polypeptide=Lus10041756 locus=Lus10041756.g ID=Lus10041756.BGIv1.0 annot-version=v1.0
ATGGCGACGGAGTCATCGGAGGGGGAAGAGGAAGGGAAAATCACCGGAGGTAGTCAGCATCTGCTAGTGGACGATGACCTCAGAGAACTGGGTAAAAAGG
CTGCTTGGAGCGTCAGCTCTTGTAAAACCGGCAATGGCGTCTCTTCTCTCCGCGACGACAATCTCGACACCTACTGGCAATCGGATGGTGCTCAGCCACA
TTTGGTGAACATTCAATTCCAGAAGAAAGTAAAGCTTCAATTGGTTTCAGTTTATGTTGATTTCAAGCTTGATGAGAGCTATACTCCCAGCAAGATCTCC
ATTCGTGCTGGTGATGGATTCCATAACCTGAAGGACATCAAAACTGTGGAATTTGTCAAGCCTACTGGTTGGGTTTGCATTTCCCTATCTGGAAATGATC
CTAGGGAAACCTTCGTGAACACGTTTATGTTACAAATTGCGGTGCTCTCAAATCACCTGAATGGAAGAGATACTCATATCCGCCAGATTAAAGTCTATGG
ACCTCGGCCGAACCCTATTCCGCATCAACCATTTCAGTTCACTTCTACAGAGTTCATCACTTACTCTACTGTCAGATGA
AA sequence
>Lus10041756 pacid=23146724 polypeptide=Lus10041756 locus=Lus10041756.g ID=Lus10041756.BGIv1.0 annot-version=v1.0
MATESSEGEEEGKITGGSQHLLVDDDLRELGKKAAWSVSSCKTGNGVSSLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVSVYVDFKLDESYTPSKIS
IRAGDGFHNLKDIKTVEFVKPTGWVCISLSGNDPRETFVNTFMLQIAVLSNHLNGRDTHIRQIKVYGPRPNPIPHQPFQFTSTEFITYSTVR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18290 EMB2783, APC10 EMBRYO DEFECTIVE 2783, anaphas... Lus10041756 0 1
AT1G05030 Major facilitator superfamily ... Lus10030010 11.0 0.8472
AT3G01435 Expressed protein (.1) Lus10022634 11.5 0.8207
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Lus10031285 20.6 0.8315
AT3G13940 DNA binding;DNA-directed RNA p... Lus10029818 21.9 0.8222
AT4G33250 ATTIF3K1, EIF3K eukaryotic translation initiat... Lus10039931 22.4 0.8272
AT5G48870 SAD1 SUPERSENSITIVE TO ABA AND DROU... Lus10011877 26.1 0.8245
AT3G17300 EMB2786 unknown protein Lus10037835 28.8 0.8286
AT5G26800 unknown protein Lus10015444 29.1 0.8275
AT5G27240 DNAJ heat shock N-terminal dom... Lus10043201 31.9 0.8259
AT2G44680 CKB4 casein kinase II beta subunit... Lus10028160 40.1 0.8212

Lus10041756 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.