Lus10041759 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18250 229 / 1e-77 ATCOAD 4-phosphopantetheine adenylyltransferase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028311 290 / 1e-101 AT2G18250 265 / 1e-91 4-phosphopantetheine adenylyltransferase (.1)
Lus10026004 249 / 2e-85 AT2G18250 267 / 2e-92 4-phosphopantetheine adenylyltransferase (.1)
Lus10014296 229 / 3e-77 AT2G18250 249 / 5e-85 4-phosphopantetheine adenylyltransferase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G121200 222 / 7e-75 AT2G18250 268 / 6e-93 4-phosphopantetheine adenylyltransferase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF01467 CTP_transf_like Cytidylyltransferase-like
Representative CDS sequence
>Lus10041759 pacid=23146877 polypeptide=Lus10041759 locus=Lus10041759.g ID=Lus10041759.BGIv1.0 annot-version=v1.0
ATGGCAGCTGAGGATGAAACGGCGATCAACTACAAGATTTCCCCGCCAAACACGTACGGATCCGTGGTGCTCGGCGGCACGTTTGATCGGCTTCACGACG
GCCATCGCCTTTTCCTCAAGGCAGCAGCCGAGCTGGCTAAGGAAAGGGTTGTTGTTGGAGTTTGCCACGGCCCTATGCTCGCCAAAAAACAGTTTGCAGA
CCTGATACAGCCTGTTGATCAAAGGATGCAGAATGTTGAAATCTTCATCAAGTCTATCAAGCCAGAGCTCCTGGTGCAAGCTGAACCAATCATTGATCCC
TATGGACCTTCAATTGTCCTCCAAGATTTGGAAGCTATAGTCGTTAGCAAAGAGACTGTACCAGGCGGCCTGGCAGTTAACAGGAAGAGAGCTGAGAAAG
GACTTTCGCAGCTCAAGATTGAAGTTGTGGATCTAATTTCTGACGGATCCAGTGGAGAGAAGCTGAGTTCCTCAACTTTGAGGCAACTCGATGCCGAGAA
GGCTAAACAACAAGCAACATAG
AA sequence
>Lus10041759 pacid=23146877 polypeptide=Lus10041759 locus=Lus10041759.g ID=Lus10041759.BGIv1.0 annot-version=v1.0
MAAEDETAINYKISPPNTYGSVVLGGTFDRLHDGHRLFLKAAAELAKERVVVGVCHGPMLAKKQFADLIQPVDQRMQNVEIFIKSIKPELLVQAEPIIDP
YGPSIVLQDLEAIVVSKETVPGGLAVNRKRAEKGLSQLKIEVVDLISDGSSGEKLSSSTLRQLDAEKAKQQAT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18250 ATCOAD 4-phosphopantetheine adenylylt... Lus10041759 0 1
AT1G78070 Transducin/WD40 repeat-like su... Lus10041102 4.1 0.8859
AT1G13750 Purple acid phosphatases super... Lus10036902 9.0 0.8624
AT2G45530 RING/U-box superfamily protein... Lus10033252 11.8 0.8558
AT4G03020 transducin family protein / WD... Lus10042682 12.0 0.8651
AT1G77930 Chaperone DnaJ-domain superfam... Lus10012702 12.2 0.8557
AT1G73170 P-loop containing nucleoside t... Lus10015985 14.3 0.8207
AT1G63900 DAL1 DIAP1-like protein 1, E3 Ubiqu... Lus10027994 14.8 0.8563
AT1G67850 Protein of unknown function (D... Lus10006472 15.0 0.8518
AT2G33590 NAD(P)-binding Rossmann-fold s... Lus10024138 17.5 0.8496
AT1G33780 Protein of unknown function (D... Lus10001286 18.1 0.8540

Lus10041759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.