Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025864 [exp] 57 / 8e-13 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041761 pacid=23146800 polypeptide=Lus10041761 locus=Lus10041761.g ID=Lus10041761.BGIv1.0 annot-version=v1.0 ATGAAGAAGGTCTCTGCTACTGAGAGCGTTGAAGAAGAAATTCACTCTGGTGAAGGCGGGGATGGTGATGGTATACAAAGCTTCAACGAGAGAATGAGCT GCGTTCTGGTGATGCCTCAGCTGATTGGTCCTGTGGCTGTCGATGCATTTATGGTGCGGCAGACTGTGATTAAGAAAAGTCCTCCGATGGAAGAAGGGCC TCGTATGAACTAA
AA sequence Show only first row Show all	>Lus10041761 pacid=23146800 polypeptide=Lus10041761 locus=Lus10041761.g ID=Lus10041761.BGIv1.0 annot-version=v1.0 MKKVSATESVEEEIHSGEGGDGDGIQSFNERMSCVLVMPQLIGPVAVDAFMVRQTVIKKSPPMEEGPRMN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041761 [exp]	0	1
					Lus10025864 [exp]	1.4	0.7541
AT5G24530		DMR6	DOWNY MILDEW RESISTANT 6, 2-ox...		Lus10015573 [exp]	4.5	0.7335
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10008600 [exp]	21.8	0.7134
AT1G13810			Restriction endonuclease, type...		Lus10017632 [exp]	27.5	0.6703
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Lus10026854 [exp]	30.3	0.7134
AT2G36900		ATMEMB11, MEMB1...	membrin 11 (.1.2)		Lus10020302 [exp]	32.9	0.7058
AT1G12920		ERF1-2	eukaryotic release factor 1-2 ...		Lus10041760 [exp]	35.5	0.6464
AT1G05600		EMB3101	EMBRYO DEFECTIVE 3101, Tetratr...		Lus10002681 [exp]	54.1	0.6863
AT4G08580			microfibrillar-associated prot...		Lus10020321 [exp]	56.2	0.6951
AT1G52343			unknown protein		Lus10035888 [exp]	59.9	0.6408

Compare expression of checked genes

Lus10041761 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.