Lus10041766 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21600 247 / 1e-84 ATRER1B endoplasmatic reticulum retrieval protein 1B (.1)
AT4G39220 246 / 5e-84 ATRER1A Rer1 family protein (.1)
AT2G18240 246 / 1e-83 Rer1 family protein (.1.2)
AT2G23310 209 / 4e-69 ATRER1C1, ATRER1C Rer1 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028319 360 / 4e-129 AT2G21600 249 / 4e-85 endoplasmatic reticulum retrieval protein 1B (.1)
Lus10041765 295 / 6e-103 AT4G39220 250 / 5e-85 Rer1 family protein (.1)
Lus10028317 286 / 2e-99 AT4G39220 254 / 8e-87 Rer1 family protein (.1)
Lus10011502 224 / 3e-75 AT4G39220 258 / 3e-88 Rer1 family protein (.1)
Lus10019323 224 / 7e-75 AT4G39220 259 / 6e-89 Rer1 family protein (.1)
Lus10002889 146 / 1e-45 AT4G39220 119 / 4e-35 Rer1 family protein (.1)
Lus10002890 115 / 5e-34 AT4G39220 112 / 7e-33 Rer1 family protein (.1)
Lus10015498 64 / 9e-13 AT4G28040 141 / 5e-41 nodulin MtN21 /EamA-like transporter family protein (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G034200 285 / 3e-99 AT2G21600 265 / 3e-91 endoplasmatic reticulum retrieval protein 1B (.1)
Potri.005G228900 279 / 6e-97 AT2G21600 235 / 1e-79 endoplasmatic reticulum retrieval protein 1B (.1)
Potri.004G156900 247 / 3e-84 AT4G39220 245 / 1e-83 Rer1 family protein (.1)
Potri.009G118500 246 / 5e-84 AT4G39220 224 / 2e-75 Rer1 family protein (.1)
Potri.007G047800 235 / 1e-79 AT4G39220 194 / 3e-63 Rer1 family protein (.1)
Potri.005G141700 214 / 4e-71 AT2G23310 200 / 2e-65 Rer1 family protein (.1.2)
Potri.004G156800 193 / 3e-63 AT4G39220 251 / 6e-86 Rer1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03248 Rer1 Rer1 family
Representative CDS sequence
>Lus10041766 pacid=23146654 polypeptide=Lus10041766 locus=Lus10041766.g ID=Lus10041766.BGIv1.0 annot-version=v1.0
ATGGAGGACGCAGGAGGAGGAAGTGAAACCGTGCCGCCGCTCGTCAAGTGGAAAGCCGACTTTTCCAGGGCGTTCCAGTACTATCTCGACAGATCCGCGC
CTCTCCCACTGCAGAGGTGGCTGGGGAGTCTGGTGGTGGCGCTGATATATGTCTGGCGGGTTTACTCTATCCAGGGTTTCTATGTCATTTCTTACGGGCT
TGGGATCTACGTCTTGAATCTGTTGATCGGTTTCCTGTCTCCGAAGGTTGATCCCGAGCTTGAAGCTCTTGAATCGCTGGACGGCGCTTCCTTGCCGACT
AAAACGTCAGATGAGTTCAGGCCGTTCGTTCGCCGGCTTCCTGAATTCAAGTTCTGGTATGCCATCACCAAGGCTTTTATAGTTGCATTCGTCATGACCT
TTTTCTCTGTGCTGGACGTGCCGGTTTTCTGGCCTATCCTCCTGATTTATTGGATTGTTCTCTTTGTTCTCACAATGAAGAGACAAATTCTGCATATGAT
CAAGTATAAGTATGTCCCATTCGACTTGGGAAAGAAGGTCAGTTAG
AA sequence
>Lus10041766 pacid=23146654 polypeptide=Lus10041766 locus=Lus10041766.g ID=Lus10041766.BGIv1.0 annot-version=v1.0
MEDAGGGSETVPPLVKWKADFSRAFQYYLDRSAPLPLQRWLGSLVVALIYVWRVYSIQGFYVISYGLGIYVLNLLIGFLSPKVDPELEALESLDGASLPT
KTSDEFRPFVRRLPEFKFWYAITKAFIVAFVMTFFSVLDVPVFWPILLIYWIVLFVLTMKRQILHMIKYKYVPFDLGKKVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21600 ATRER1B endoplasmatic reticulum retrie... Lus10041766 0 1
AT2G43330 ATINT1 inositol transporter 1 (.1) Lus10025565 1.7 0.8790
AT4G27650 PEL1 PELOTA, Eukaryotic release fac... Lus10020376 3.5 0.8699
AT5G11150 ATVAMP713 vesicle-associated membrane pr... Lus10001492 4.7 0.8597
AT1G03140 splicing factor Prp18 family p... Lus10042599 6.3 0.8685
AT1G03350 BSD domain-containing protein ... Lus10012761 9.0 0.8666
AT5G26990 Drought-responsive family prot... Lus10015214 10.8 0.8546
AT1G03140 splicing factor Prp18 family p... Lus10022049 11.2 0.8273
AT5G54310 NEV, AGD5 NEVERSHED, ARF-GAP domain 5 (.... Lus10037882 15.2 0.8365
AT1G13570 F-box/RNI-like superfamily pro... Lus10030920 15.4 0.8752
AT5G67380 ATCKA1, CKA1 casein kinase alpha 1 (.1.2) Lus10019288 15.5 0.8709

Lus10041766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.