Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17740 103 / 5e-27 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17730 91 / 1e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17760 89 / 6e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT2G18190 81 / 4e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G18193 78 / 3e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G50940 76 / 2e-17 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G50930 74 / 2e-16 BCS1 cytochrome BC1 synthesis (.1) AT3G29800 73 / 3e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G40000 71 / 1e-15 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28600 69 / 6e-15 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015802 [exp] 89 / 1e-21 AT3G50940 462 / 9e-161 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10003213 [exp] 87 / 4e-21 AT5G17740 430 / 7e-146 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10037004 [exp] 86 / 6e-21 AT3G50930 457 / 9e-159 cytochrome BC1 synthesis (.1) Lus10041918 [exp] 72 / 1e-15 AT3G50930 383 / 2e-126 cytochrome BC1 synthesis (.1) Lus10024275 [exp] 71 / 2e-15 AT3G50940 434 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10031318 [exp] 69 / 7e-15 AT2G18193 415 / 1e-140 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10014284 [exp] 66 / 8e-14 AT3G50930 535 / 0.0 cytochrome BC1 synthesis (.1) Lus10025989 [exp] 64 / 3e-13 AT3G50930 445 / 1e-153 cytochrome BC1 synthesis (.1) Lus10014497 [exp] 64 / 3e-13 AT3G28580 463 / 7e-160 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G119900 [exp] 105 / 6e-28 AT5G17760 512 / 3e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.007G020600 [exp] 94 / 8e-24 AT2G18193 553 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.007G020500 [exp] 91 / 8e-23 AT2G18193 511 / 1e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.007G020800 [exp] 89 / 4e-22 AT5G17760 506 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.008G177200 [exp] 85 / 1e-20 AT3G50940 401 / 4e-136 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.010G057900 [exp] 82 / 1e-19 AT3G50930 396 / 1e-133 cytochrome BC1 synthesis (.1) Potri.002G032700 [exp] 81 / 5e-19 AT3G50930 437 / 1e-149 cytochrome BC1 synthesis (.1) Potri.009G119132 [exp] 74 / 2e-16 AT3G50930 484 / 3e-166 cytochrome BC1 synthesis (.1) Potri.007G012400 [exp] 72 / 4e-16 AT3G50940 367 / 2e-123 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.009G119066 [exp] 72 / 8e-16 AT3G50930 471 / 4e-161 cytochrome BC1 synthesis (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041778 pacid=23146803 polypeptide=Lus10041778 locus=Lus10041778.g ID=Lus10041778.BGIv1.0 annot-version=v1.0 ATGGACATGCTCATCCACATGTCCTACTGCTCCAATGAAGGGTTCAAATTGCTTGCAAACAACTATTTGGGAATCAATACTACCGGTGATGAAATGCACA AGCTTTGCGGAGAAATTGGAGGGTTGATAGAAGAGGTTAAAGTAAGCCCTGCTCAAGTGGCAGAGGAGCTTATGAAGACTGAAGATGCCAACGTGGCACT TGAGGGGCTGGTGAATATGCTCAAGAGGAAGAGAGTTGAACTAGGCGAAGCTGCAGATAGCAATAAGGGTTCTACTGATATTGTGAAGAGGCTGAGAGTG AGAGTGAGGAAAGGAGAGTGA
AA sequence Show only first row Show all	>Lus10041778 pacid=23146803 polypeptide=Lus10041778 locus=Lus10041778.g ID=Lus10041778.BGIv1.0 annot-version=v1.0 MDMLIHMSYCSNEGFKLLANNYLGINTTGDEMHKLCGEIGGLIEEVKVSPAQVAEELMKTEDANVALEGLVNMLKRKRVELGEAADSNKGSTDIVKRLRV RVRKGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17730			P-loop containing nucleoside t...		Lus10041778 [exp]	0	1
					Lus10030647 [exp]	5.1	0.7073
AT5G17760			P-loop containing nucleoside t...		Lus10041777 [exp]	10.2	0.6445
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001036 [exp]	12.0	0.5934
AT3G10710		RHS12	root hair specific 12 (.1)		Lus10034859 [exp]	18.2	0.5763
AT1G04560			AWPM-19-like family protein (....		Lus10033541 [exp]	29.8	0.5429
AT5G14750	MYB	WER1, WER, AtMY...	WEREWOLF 1, WEREWOLF, myb doma...		Lus10007008 [exp]	39.1	0.5458
					Lus10003448 [exp]	41.0	0.5879
AT3G07820			Pectin lyase-like superfamily ...		Lus10013783 [exp]	65.8	0.4682
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001042 [exp]	69.4	0.5420
					Lus10005203 [exp]	90.8	0.4939

Compare expression of checked genes

Lus10041778 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.