Lus10041781 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66430 54 / 4e-09 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT5G04380 54 / 5e-09 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT1G19640 51 / 4e-08 JMT jasmonic acid carboxyl methyltransferase (.1)
AT4G36470 51 / 6e-08 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT3G11480 48 / 5e-07 BSMT1, ATBSMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT5G04370 44 / 1e-05 NAMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
AT3G21950 42 / 8e-05 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT5G38020 41 / 0.0002 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT2G14060 40 / 0.0003 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025993 110 / 6e-29 AT1G19640 288 / 1e-93 jasmonic acid carboxyl methyltransferase (.1)
Lus10036548 88 / 9e-21 AT5G66430 250 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10036547 85 / 5e-20 AT5G66430 243 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10041380 78 / 2e-17 AT4G36470 278 / 4e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10036550 78 / 2e-17 AT3G11480 249 / 8e-80 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10024671 75 / 3e-16 AT5G66430 280 / 2e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10024271 65 / 8e-13 AT1G19640 315 / 2e-105 jasmonic acid carboxyl methyltransferase (.1)
Lus10041381 54 / 4e-10 AT3G11480 47 / 1e-07 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10041776 40 / 0.0005 AT4G36470 421 / 3e-147 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G021300 102 / 2e-26 AT3G11480 318 / 1e-106 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G022400 65 / 6e-13 AT3G11480 311 / 4e-104 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G022000 65 / 9e-13 AT3G11480 300 / 7e-100 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G022002 64 / 2e-12 AT3G11480 309 / 3e-103 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G022402 63 / 4e-12 AT3G11480 261 / 1e-84 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.014G168232 57 / 1e-10 AT1G19640 114 / 1e-30 jasmonic acid carboxyl methyltransferase (.1)
Potri.005G230100 50 / 1e-07 AT1G19640 389 / 1e-134 jasmonic acid carboxyl methyltransferase (.1)
Potri.019G022200 47 / 1e-06 AT5G04370 227 / 1e-71 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Potri.005G045900 44 / 2e-05 AT1G19640 271 / 3e-88 jasmonic acid carboxyl methyltransferase (.1)
Potri.015G041900 41 / 0.0002 AT1G68040 275 / 2e-89 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Representative CDS sequence
>Lus10041781 pacid=23146977 polypeptide=Lus10041781 locus=Lus10041781.g ID=Lus10041781.BGIv1.0 annot-version=v1.0
ATGTCTTATTGCATCATTTGGAAGACTTCAAAGAGTACTTTAGGCACTAAAGGGCGAGGCGAAGGGGGAGAGCACACCTGGAATCCTGGACTAGGATCCA
AGATCTCTCCAGGTTCTACAAACTTCAACATCCCAGAATACATGCCGTCGCCCATGGAAGTGGAATCTGAGGTGAAGAATAAGGGGTCATTTGTCATAGA
TGAGTTGGAGGTTTCTGAAGTGAGCTGGGACGCCCACAATGACGACGAGTACTTCAACATGGTATCTGGCGAAGCAACCAGAGCAAACAGCGTGGAGAAG
TGCATTAGGGCGGTGGCGGAACCGCTGCAAGTCAACCACTCCGGTGGTGGGGAAGTAATGATCGACGAGGTGTTCGAGAGATACAGAGTCATTGCCTCGA
AGCGTAAGGCCAATGATGAAAAGACTGGATTGTTCGTTTTTTTCACTGTGTCTCTCACCAATACTAGCTAG
AA sequence
>Lus10041781 pacid=23146977 polypeptide=Lus10041781 locus=Lus10041781.g ID=Lus10041781.BGIv1.0 annot-version=v1.0
MSYCIIWKTSKSTLGTKGRGEGGEHTWNPGLGSKISPGSTNFNIPEYMPSPMEVESEVKNKGSFVIDELEVSEVSWDAHNDDEYFNMVSGEATRANSVEK
CIRAVAEPLQVNHSGGGEVMIDEVFERYRVIASKRKANDEKTGLFVFFTVSLTNTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66430 S-adenosyl-L-methionine-depend... Lus10041781 0 1

Lus10041781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.