Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29080 98 / 3e-25 Papain family cysteine protease (.1) AT1G06260 96 / 1e-24 Cysteine proteinases superfamily protein (.1) AT1G29090 95 / 2e-24 Cysteine proteinases superfamily protein (.1) AT2G34080 93 / 1e-23 Cysteine proteinases superfamily protein (.1) AT5G50260 92 / 6e-23 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) AT2G27420 91 / 2e-22 Cysteine proteinases superfamily protein (.1) AT5G45890 90 / 2e-22 SAG12 senescence-associated gene 12 (.1) AT3G48350 89 / 4e-22 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1) AT1G29110 87 / 1e-21 Cysteine proteinases superfamily protein (.1) AT3G48340 86 / 5e-21 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020731 [exp] 142 / 3e-42 AT5G45890 344 / 1e-117 senescence-associated gene 12 (.1) Lus10028502 [exp] 106 / 2e-28 AT5G45890 394 / 3e-137 senescence-associated gene 12 (.1) Lus10028501 [exp] 106 / 2e-28 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1) Lus10032406 [exp] 105 / 4e-28 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1) Lus10020730 [exp] 105 / 6e-28 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1) Lus10006542 [exp] 104 / 7e-28 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1) Lus10029799 [exp] 104 / 8e-28 AT5G45890 393 / 3e-137 senescence-associated gene 12 (.1) Lus10003275 [exp] 104 / 8e-28 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1) Lus10026073 [exp] 104 / 9e-28 AT5G45890 393 / 5e-137 senescence-associated gene 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G056301 [exp] 100 / 1e-27 AT5G45890 254 / 7e-85 senescence-associated gene 12 (.1) Potri.004G056308 [exp] 100 / 1e-27 AT5G45890 254 / 7e-85 senescence-associated gene 12 (.1) Potri.004G056050 [exp] 96 / 7e-26 AT5G45890 263 / 3e-88 senescence-associated gene 12 (.1) Potri.005G089100 [exp] 99 / 9e-26 AT5G45890 405 / 1e-141 senescence-associated gene 12 (.1) Potri.004G056366 [exp] 98 / 2e-25 AT5G45890 416 / 5e-146 senescence-associated gene 12 (.1) Potri.004G056000 [exp] 98 / 3e-25 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1) Potri.004G056500 [exp] 98 / 3e-25 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1) Potri.004G056200 [exp] 97 / 3e-25 AT5G45890 420 / 1e-147 senescence-associated gene 12 (.1) Potri.007G075100 [exp] 96 / 5e-25 AT5G45890 371 / 4e-129 senescence-associated gene 12 (.1) Potri.007G076000 [exp] 97 / 6e-25 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [flax] [poplar] Peptidase_CA PF00112 [flax] [poplar] Peptidase_C1 Papain family cysteine protease
Representative CDS sequence Show only first row Show all	>Lus10041788 pacid=23147078 polypeptide=Lus10041788 locus=Lus10041788.g ID=Lus10041788.BGIv1.0 annot-version=v1.0 ATGCCGATCCCTGATGCCACCGGTCGCACTACTCATAGGGTCCGAGGACGTGTCGGCCAACGACGAAATTTCGTTGCTCAAGGCCGTGGCCAACCAGCCA TTTCGGTCGGGATTTGCAGGACTGATCCCTCTTTCAAGTTTTACCAGGGCTGGATCCTGACACCTGACGTGTGCGGGACCGCCACGAACCATGCGGTGAC ATTGGTTGGGTACGGGGATAGCGATAGGAGGAAGTACTGGCTGGCGAAGAACTCGTGGGGAAATCAGTGGGGGGAGCAAGGTTACGTTCGGTTGGAGAGA GGTGTTGCGGTTGATGAAGGGGTATGTGGGCTTGCTCAATATGCTTCTTACCCTACTATTACTGCTGCGCCTTAG
AA sequence Show only first row Show all	>Lus10041788 pacid=23147078 polypeptide=Lus10041788 locus=Lus10041788.g ID=Lus10041788.BGIv1.0 annot-version=v1.0 MPIPDATGRTTHRVRGRVGQRRNFVAQGRGQPAISVGICRTDPSFKFYQGWILTPDVCGTATNHAVTLVGYGDSDRRKYWLAKNSWGNQWGEQGYVRLER GVAVDEGVCGLAQYASYPTITAAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06260			Cysteine proteinases superfami...		Lus10041788 [exp]	0	1
AT2G41480			Peroxidase superfamily protein...		Lus10009990 [exp]	1.4	0.8288
AT3G23560		ALF5	ABERRANT LATERAL ROOT FORMATIO...		Lus10012961 [exp]	5.3	0.6667
AT3G02310	MADS	AGL4, SEP2	SEPALLATA 2, AGAMOUS-like 4, K...		Lus10004638 [exp]	10.4	0.7946
AT2G33810	SBP	SPL3	squamosa promoter binding prot...		Lus10013999 [exp]	12.6	0.6925
AT2G29050		ATRBL1	RHOMBOID-like 1 (.1.2)		Lus10004965 [exp]	19.8	0.7429
					Lus10032831 [exp]	22.2	0.6318
AT5G14210			Leucine-rich repeat protein ki...		Lus10041589 [exp]	22.3	0.6043
AT2G20340			Pyridoxal phosphate (PLP)-depe...		Lus10018522 [exp]	32.6	0.6809
AT5G28237			Pyridoxal-5'-phosphate-depende...		Lus10018358 [exp]	34.4	0.7114
					Lus10006666 [exp]	44.7	0.6424

Compare expression of checked genes

Lus10041788 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.