Lus10041789 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66380 110 / 3e-29 ATFOLT1 folate transporter 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028339 129 / 9e-37 AT5G66380 384 / 2e-135 folate transporter 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G019000 120 / 5e-33 AT5G66380 463 / 8e-166 folate transporter 1 (.1)
PFAM info
Representative CDS sequence
>Lus10041789 pacid=23146855 polypeptide=Lus10041789 locus=Lus10041789.g ID=Lus10041789.BGIv1.0 annot-version=v1.0
ATGGCAGAACGCCACCGCCGGTGCTGTGGCTGGGGTCTCCACTGGCTGGGTTCTCCACTGTCGCTGCTATGCATCCTCTTGACGTCGTCCGGACTAGTTA
ACGATGGTCGAATCTCCAGCCTCCCGACTTACAGGAATACTGCCCACGCTATTTATACCATTGCTCGCTTAGAGGTTACCAGTGCCAACATAGTTAGTTC
AACTGTTGCAGGGGCTGAGAGGGCTTTATGCAGGGTTCTCTCCAGCTGTCCTTGGTTCTACAGTTGCATGGGCTATAGCAGAGCTAAACAAAGGTATTCA
AAGAACAGGAATGAAAGCCTGAGCCCTCTTCTTCATCTTGCATCTGCTGCAGAAGCTGGAGGCTTGGTTTCTCATGGTGCCATCCAGTTCACTGCATACG
AGGAACTACGCAAACTAATTCTTCACCACAGATCTAAAGTGACAAAAGGCCACCATGATAGCGCAGACATTAATTTGCTGAATTCGGTTGACTACGCTGT
CCTTGGTGGTTCTTCGAAACTTTCGGCTATTCTCCTGACGCATCCATTTCAGCAACGCCCTGGTATCGATGGAATTCCAAGATATATGGATAGCTTGCAT
GTCTTGAAGGAAACATTTCGGTGA
AA sequence
>Lus10041789 pacid=23146855 polypeptide=Lus10041789 locus=Lus10041789.g ID=Lus10041789.BGIv1.0 annot-version=v1.0
MAERHRRCCGWGLHWLGSPLSLLCILLTSSGLVNDGRISSLPTYRNTAHAIYTIARLEVTSANIVSSTVAGAERALCRVLSSCPWFYSCMGYSRAKQRYS
KNRNESLSPLLHLASAAEAGGLVSHGAIQFTAYEELRKLILHHRSKVTKGHHDSADINLLNSVDYAVLGGSSKLSAILLTHPFQQRPGIDGIPRYMDSLH
VLKETFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66380 ATFOLT1 folate transporter 1 (.1) Lus10041789 0 1
AT5G04550 Protein of unknown function (D... Lus10002840 2.0 0.6872
AT2G44760 Domain of unknown function (DU... Lus10020744 15.2 0.6105
Lus10022857 16.8 0.6053
AT5G26650 MADS AGL36 AGAMOUS-like 36 (.1) Lus10016180 18.8 0.6236
AT3G15280 unknown protein Lus10005404 21.1 0.6206
AT1G69480 EXS (ERD1/XPR1/SYG1) family pr... Lus10004285 28.3 0.5953
Lus10019810 29.5 0.6125
AT2G29040 Exostosin family protein (.1) Lus10003440 47.6 0.5732
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10031579 49.9 0.5758
AT5G24090 ATCHIA chitinase A (.1) Lus10037984 53.7 0.5447

Lus10041789 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.