Lus10041791 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75440 246 / 9e-85 UBC16 ubiquitin-conjugating enzyme 16 (.1)
AT5G42990 241 / 1e-82 UBC18 ubiquitin-conjugating enzyme 18 (.1)
AT1G45050 238 / 2e-81 ATUBC2-1, UBC15 Arabidopsis thaliana ubiquitin-conjugating enzyme 15, Ubiquitin-conjugating enzyme family protein (.1)
AT4G36410 228 / 2e-77 UBC17 ubiquitin-conjugating enzyme 17 (.1)
AT2G16740 67 / 2e-14 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08690 66 / 6e-14 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G53300 64 / 3e-13 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT5G56150 64 / 4e-13 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT4G27960 63 / 6e-13 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G41700 62 / 9e-13 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028341 227 / 2e-77 AT1G75440 250 / 8e-87 ubiquitin-conjugating enzyme 16 (.1)
Lus10032352 68 / 1e-14 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10033937 68 / 1e-14 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10028700 67 / 1e-14 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10009422 67 / 1e-14 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10027570 66 / 4e-14 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 66 / 4e-14 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 66 / 4e-14 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 66 / 4e-14 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G030800 266 / 8e-93 AT5G42990 251 / 9e-87 ubiquitin-conjugating enzyme 18 (.1)
Potri.005G118600 261 / 8e-91 AT1G75440 296 / 1e-104 ubiquitin-conjugating enzyme 16 (.1)
Potri.007G018700 259 / 7e-90 AT1G75440 295 / 3e-104 ubiquitin-conjugating enzyme 16 (.1)
Potri.005G232100 250 / 4e-86 AT5G42990 256 / 1e-88 ubiquitin-conjugating enzyme 18 (.1)
Potri.015G023300 68 / 1e-14 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.012G033000 68 / 1e-14 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.001G094900 68 / 1e-14 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G083800 65 / 1e-13 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.016G138900 65 / 2e-13 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 64 / 2e-13 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10041791 pacid=23146760 polypeptide=Lus10041791 locus=Lus10041791.g ID=Lus10041791.BGIv1.0 annot-version=v1.0
ATGACCAGTTCCTCCGCCACCGCTCGCAAGACACTGAGTAAGATCGCTTGCAATCGGCTTCAGAAGGAGTTGGTGGAGTGGCAGGTCAATCCAAGGGGTT
GGTGGAGTGGCAGGTGGGTGATTGAAGTAAATGGAGCTCCTGGAACCCTCTATGCTAATGAAATGTACCAGCTCCAAGTTGATTTCCCTGAGCATTACCC
AATGGAAGCGCCCCAGGTTATATTTCTTCATCCAGCTCCACTACACCCTCACATTTACAGCAACGGCCATATTTGTTTAGAACAGTGTTCGATTGTCAAA
GAAAAGCTTACACCAATGAATTTACTCCTCGCAGATATATTATACGATTCTTGGTCACCTGCTATGACTGTTAGTTCTGTGTGTATCAGCATCCTTTCAA
TGCTGTCAAGCTCAACTGTTAAGCAACGCCCTGAAGACAATGATCGCTATGTGAAGAACTGCCGAAACGGAAGATCTCCGAAGGAGACCAGGTGGTGGTT
CCATGATGACAAGGTGTAA
AA sequence
>Lus10041791 pacid=23146760 polypeptide=Lus10041791 locus=Lus10041791.g ID=Lus10041791.BGIv1.0 annot-version=v1.0
MTSSSATARKTLSKIACNRLQKELVEWQVNPRGWWSGRWVIEVNGAPGTLYANEMYQLQVDFPEHYPMEAPQVIFLHPAPLHPHIYSNGHICLEQCSIVK
EKLTPMNLLLADILYDSWSPAMTVSSVCISILSMLSSSTVKQRPEDNDRYVKNCRNGRSPKETRWWFHDDKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75440 UBC16 ubiquitin-conjugating enzyme 1... Lus10041791 0 1
AT2G28060 5'-AMP-activated protein kinas... Lus10008427 7.1 0.8625
AT1G15910 FDM1 factor of DNA methylation 1, X... Lus10036870 8.2 0.8616
AT3G56720 unknown protein Lus10038984 8.5 0.8566
AT1G24095 Putative thiol-disulphide oxid... Lus10030833 9.5 0.8275
AT5G14930 GENE101, SAG101 senescence-associated gene 101... Lus10011697 11.5 0.8405
AT5G67170 SEC-C motif-containing protein... Lus10006255 23.5 0.8375
AT1G70650 Ran BP2/NZF zinc finger-like s... Lus10003580 24.5 0.8519
AT2G31130 unknown protein Lus10000990 33.6 0.8141
AT1G49170 Protein of unknown function (D... Lus10020853 33.9 0.7596
AT3G18215 Protein of unknown function, D... Lus10009640 35.8 0.8336

Lus10041791 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.