Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51060 81 / 4e-19 SRS1, STY1 STYLISH 1, SHI RELATED SEQUENCE 1, Lateral root primordium (LRP) protein-related (.1) AT5G66350 79 / 1e-18 SHI SHORT INTERNODES, Lateral root primordium (LRP) protein-related (.1) AT1G19790 68 / 2e-14 SRS7 SHI-related sequence 7 (.1.2) AT1G75520 66 / 1e-13 SRS5 SHI-related sequence 5 (.1) AT4G36260 58 / 8e-11 SRS2, STY2 STYLISH 2, SHI RELATED SEQUENCE 2, Lateral root primordium (LRP) protein-related (.1) AT2G21400 49 / 3e-08 SRS3 SHI-related sequence3 (.1) AT2G18120 49 / 5e-08 SRS4 SHI-related sequence 4 (.1) AT5G12330 46 / 7e-07 LRP1 LATERAL ROOT PRIMORDIUM 1, Lateral root primordium (LRP) protein-related (.1), Lateral root primordium (LRP) protein-related (.2), Lateral root primordium (LRP) protein-related (.3), Lateral root primordium (LRP) protein-related (.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028352 [exp] 196 / 2e-63 AT3G51060 243 / 4e-78 STYLISH 1, SHI RELATED SEQUENCE 1, Lateral root primordium (LRP) protein-related (.1) Lus10024305 [exp] 68 / 3e-14 AT1G75520 260 / 8e-85 SHI-related sequence 5 (.1) Lus10003416 [exp] 67 / 5e-14 AT1G75520 258 / 6e-84 SHI-related sequence 5 (.1) Lus10017492 [exp] 49 / 5e-08 AT2G21400 120 / 1e-34 SHI-related sequence3 (.1) Lus10036032 [exp] 49 / 1e-07 AT5G12330 214 / 2e-68 LATERAL ROOT PRIMORDIUM 1, Lateral root primordium (LRP) protein-related (.1), Lateral root primordium (LRP) protein-related (.2), Lateral root primordium (LRP) protein-related (.3), Lateral root primordium (LRP) protein-related (.4) Lus10028794 [exp] 45 / 3e-06 AT5G66350 123 / 5e-34 SHORT INTERNODES, Lateral root primordium (LRP) protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G017500 [exp] 94 / 6e-24 AT3G51060 238 / 6e-76 STYLISH 1, SHI RELATED SEQUENCE 1, Lateral root primordium (LRP) protein-related (.1) Potri.005G118200 [exp] 87 / 1e-21 AT3G51060 233 / 6e-74 STYLISH 1, SHI RELATED SEQUENCE 1, Lateral root primordium (LRP) protein-related (.1) Potri.002G028500 [exp] 70 / 2e-15 AT1G75520 261 / 1e-85 SHI-related sequence 5 (.1) Potri.005G234200 [exp] 66 / 9e-14 AT1G75520 222 / 2e-70 SHI-related sequence 5 (.1) Potri.004G160600 [exp] 55 / 3e-10 AT5G66350 170 / 4e-52 SHORT INTERNODES, Lateral root primordium (LRP) protein-related (.1) Potri.009G121600 [exp] 50 / 4e-08 AT5G66350 181 / 3e-56 SHORT INTERNODES, Lateral root primordium (LRP) protein-related (.1) Potri.001G276200 [exp] 45 / 1e-06 AT5G12330 226 / 2e-71 LATERAL ROOT PRIMORDIUM 1, Lateral root primordium (LRP) protein-related (.1), Lateral root primordium (LRP) protein-related (.2), Lateral root primordium (LRP) protein-related (.3), Lateral root primordium (LRP) protein-related (.4) Potri.009G070800 [exp] 43 / 9e-06 AT5G12330 231 / 9e-74 LATERAL ROOT PRIMORDIUM 1, Lateral root primordium (LRP) protein-related (.1), Lateral root primordium (LRP) protein-related (.2), Lateral root primordium (LRP) protein-related (.3), Lateral root primordium (LRP) protein-related (.4) Potri.001G027700 [exp] 41 / 6e-05 AT5G12330 157 / 4e-46 LATERAL ROOT PRIMORDIUM 1, Lateral root primordium (LRP) protein-related (.1), Lateral root primordium (LRP) protein-related (.2), Lateral root primordium (LRP) protein-related (.3), Lateral root primordium (LRP) protein-related (.4) Potri.003G196100 [exp] 41 / 6e-05 AT5G12330 159 / 8e-47 LATERAL ROOT PRIMORDIUM 1, Lateral root primordium (LRP) protein-related (.1), Lateral root primordium (LRP) protein-related (.2), Lateral root primordium (LRP) protein-related (.3), Lateral root primordium (LRP) protein-related (.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05142 [flax] [poplar] DUF702 Domain of unknown function (DUF702)
Representative CDS sequence Show only first row Show all	>Lus10041803 pacid=23146908 polypeptide=Lus10041803 locus=Lus10041803.g ID=Lus10041803.BGIv1.0 annot-version=v1.0 ATGAGCGGAGTTGACGATAGCGATGCACAGCAGTACGCGTACCAGACGGCGGTGAGCATTGGAGGCCACACTTTCAAAGGGATATTGTACGATCAAGGTC GGCTAGGTGGTGGAGAGAGCTCTAGTTACATGGCGGCAACTACCGACACTTCATCAGCCAGTGGTGTACAACCCCTCAATCTCATTACCACCGCCGCTTC GGCCTCAGCATCAGCGTCCTCCAACATCGGCAGCGGCGGAGTCACGTCCAATGCCGCCGGAGCTAGCTACTTGGATCCGTCCTCGTTGTACACTGCTGTA CCGCTAAGTAACTACATGGCTGGTACGCAATTCTTCCCGAATAACCCGAGATAA
AA sequence Show only first row Show all	>Lus10041803 pacid=23146908 polypeptide=Lus10041803 locus=Lus10041803.g ID=Lus10041803.BGIv1.0 annot-version=v1.0 MSGVDDSDAQQYAYQTAVSIGGHTFKGILYDQGRLGGGESSSYMAATTDTSSASGVQPLNLITTAASASASASSNIGSGGVTSNAAGASYLDPSSLYTAV PLSNYMAGTQFFPNNPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51060		SRS1, STY1	STYLISH 1, SHI RELATED SEQUENC...		Lus10041803 [exp]	0	1
AT5G66350		SHI	SHORT INTERNODES, Lateral root...		Lus10041802 [exp]	1.0	0.9046
AT3G26120		TEL1	terminal EAR1-like 1 (.1)		Lus10006234 [exp]	2.0	0.9025
AT1G48170			unknown protein		Lus10011844 [exp]	2.4	0.8598
AT1G64520		RPN12A	regulatory particle non-ATPase...		Lus10001813 [exp]	4.9	0.8205
AT5G42630	GARP	KAN4, KANADI4, ...	KANADI 4, ABERRANT TESTA SHAPE...		Lus10011660 [exp]	5.5	0.8159
AT3G51060		SRS1, STY1	STYLISH 1, SHI RELATED SEQUENC...		Lus10028352 [exp]	6.0	0.8082
AT5G65520			Tetratricopeptide repeat (TPR)...		Lus10025714 [exp]	6.5	0.8110
AT4G36920	AP2_ERF	FL1, FLO2, AP2	FLORAL MUTANT 2, FLOWER 1, APE...		Lus10009374 [exp]	8.4	0.8078
AT5G44280		ATRING1A	ARABIDOPSIS THALIANA RING 1A, ...		Lus10018609 [exp]	8.9	0.8203
AT1G79840	HD	GL2	GLABRA 2, HD-ZIP IV family of ...		Lus10037554 [exp]	9.4	0.7963

Compare expression of checked genes

Lus10041803 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.