Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17280 62 / 2e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028356 [exp] 169 / 2e-55 AT5G17280 64 / 1e-13 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G017200 [exp] 65 / 2e-14 AT5G17280 44 / 5e-06 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09791 [flax] [poplar] Oxidored-like Oxidoreductase-like protein, N-terminal
Representative CDS sequence Show only first row Show all	>Lus10041805 pacid=23146781 polypeptide=Lus10041805 locus=Lus10041805.g ID=Lus10041805.BGIv1.0 annot-version=v1.0 ATGAGAAATCTCAGCCTCAGACCAATCCTATCACCGTTCCTCGCCATTCACCACCACCACCGCAGGGTCGCCGCTCCCAAGCTTTCAACCTTTAGCGCCG ATCCTATCCCTAGAATGGAAGCTAAGGTCGAGCCAGATCGCGGAGGTTCAACAGAGACTTTCGACAGAAACAAGAAAGAAGAGAAGGAAAAGGAGAAGAC GGAGAAGGCGATTCCGCCGCCGCCGGAGAAACCGGAGCCAGGAGATTGCTGCGGGAGCGGATGCGTGAGATGCGTTTGGGACGTTTATTACGAGGAGCTG GAGGATTACAACAAGATGTATGAAACTGTTGCAGACGCGTCTGGGTCGTAA
AA sequence Show only first row Show all	>Lus10041805 pacid=23146781 polypeptide=Lus10041805 locus=Lus10041805.g ID=Lus10041805.BGIv1.0 annot-version=v1.0 MRNLSLRPILSPFLAIHHHHRRVAAPKLSTFSADPIPRMEAKVEPDRGGSTETFDRNKKEEKEKEKTEKAIPPPPEKPEPGDCCGSGCVRCVWDVYYEEL EDYNKMYETVADASGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17280			unknown protein		Lus10041805 [exp]	0	1
AT4G04770		ABCI8, ATNAP1, ...	LONG AFTER FR, ARABIDOPSIS THA...		Lus10034750 [exp]	2.4	0.8529
AT1G17080			Ribosomal protein L18ae family...		Lus10005580 [exp]	8.7	0.8299
AT1G17080			Ribosomal protein L18ae family...		Lus10013712 [exp]	11.4	0.8424
AT1G31940			unknown protein		Lus10012117 [exp]	11.6	0.8440
AT5G02040		PRA1.A1	prenylated RAB acceptor 1.A1 (...		Lus10022592 [exp]	16.5	0.8130
AT5G22950		VPS24.1	SNF7 family protein (.1)		Lus10016143 [exp]	17.5	0.8242
AT3G22950		ATARFC1	ADP-ribosylation factor C1 (.1...		Lus10039392 [exp]	20.9	0.7958
AT2G43760			molybdopterin biosynthesis Moa...		Lus10026805 [exp]	21.9	0.8167
AT5G56340		ATCRT1	RING/U-box superfamily protein...		Lus10013397 [exp]	22.8	0.8252
AT1G14340			RNA-binding (RRM/RBD/RNP motif...		Lus10030491 [exp]	27.9	0.7849

Compare expression of checked genes

Lus10041805 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.