Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54340 57 / 6e-11 MADS AP3, ATAP3 APETALA 3, K-box region and MADS-box transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031960 [exp] 71 / 2e-16 AT3G54340 275 / 5e-94 APETALA 3, K-box region and MADS-box transcription factor family protein (.1) Lus10010630 [exp] 70 / 5e-16 AT3G54340 279 / 1e-95 APETALA 3, K-box region and MADS-box transcription factor family protein (.1) Lus10033187 [exp] 70 / 7e-16 AT3G54340 275 / 4e-94 APETALA 3, K-box region and MADS-box transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G118000 [exp] 72 / 1e-16 AT3G54340 226 / 9e-75 APETALA 3, K-box region and MADS-box transcription factor family protein (.1) Potri.007G017000 [exp] 67 / 5e-15 AT3G54340 208 / 1e-67 APETALA 3, K-box region and MADS-box transcription factor family protein (.1) Potri.002G028400 [exp] 57 / 2e-11 AT3G54340 229 / 7e-77 APETALA 3, K-box region and MADS-box transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01486 [flax] [poplar] K-box K-box region
Representative CDS sequence Show only first row Show all	>Lus10041807 pacid=23146794 polypeptide=Lus10041807 locus=Lus10041807.g ID=Lus10041807.BGIv1.0 annot-version=v1.0 ATGCTTCATCACTACCAACAAACCTTAGGTCTTGATATGTGGGTCACACATTACCAGTTAAAAATCGTGCTGAACATAGTTAGAGAGACGTTGCAGAGGA TGCAGAAGACATTGATGAAGCTGAAAGAGCTCAACCATAAGCTCAAGACACAGATCAAGCAAAGAATGGGTGAGGAATTGCATCAGCTGAGATCAATCGA TGAGCTTAGAAGCCTGGAGCTAAGTATGACTTCTTCTATCGATGCCATACGTGAAAGGAAGGTGCCTAAAATAAATTAG
AA sequence Show only first row Show all	>Lus10041807 pacid=23146794 polypeptide=Lus10041807 locus=Lus10041807.g ID=Lus10041807.BGIv1.0 annot-version=v1.0 MLHHYQQTLGLDMWVTHYQLKIVLNIVRETLQRMQKTLMKLKELNHKLKTQIKQRMGEELHQLRSIDELRSLELSMTSSIDAIRERKVPKIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G54340	MADS	AP3, ATAP3	APETALA 3, K-box region and MA...		Lus10041807 [exp]	0	1
AT5G37730			unknown protein		Lus10017628 [exp]	1.0	0.9304
AT2G32190			unknown protein		Lus10031782 [exp]	2.8	0.8038
AT4G25350		SHB1	SHORT HYPOCOTYL UNDER BLUE1, E...		Lus10037146 [exp]	4.9	0.7682
AT3G04290		ATLTL1, LTL1	Li-tolerant lipase 1 (.1)		Lus10036966 [exp]	6.3	0.7678
AT2G39530			Uncharacterised protein family...		Lus10031305 [exp]	8.1	0.7593
					Lus10000914 [exp]	8.8	0.7593
AT3G12890		ASML2	activator of spomin::LUC2 (.1)		Lus10031770 [exp]	8.9	0.7325
AT3G12890		ASML2	activator of spomin::LUC2 (.1)		Lus10031192 [exp]	11.8	0.7632
AT5G59700			Protein kinase superfamily pro...		Lus10023324 [exp]	15.5	0.6792
AT5G16530		PIN5	PIN-FORMED 5, Auxin efflux car...		Lus10026994 [exp]	30.1	0.7313

Compare expression of checked genes

Lus10041807 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.