Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66330 130 / 1e-37 Leucine-rich repeat (LRR) family protein (.1) AT2G15320 40 / 9e-05 Leucine-rich repeat (LRR) family protein (.1) AT5G51560 39 / 0.0001 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028359 [exp] 110 / 6e-30 AT5G66330 423 / 5e-147 Leucine-rich repeat (LRR) family protein (.1) Lus10027040 [exp] 41 / 5e-05 AT3G59510 199 / 5e-62 Leucine-rich repeat (LRR) family protein (.1) Lus10025578 [exp] 38 / 0.0006 AT3G59510 388 / 6e-133 Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G016800 [exp] 160 / 6e-49 AT5G66330 480 / 8e-169 Leucine-rich repeat (LRR) family protein (.1) Potri.005G117800 [exp] 150 / 3e-45 AT5G66330 506 / 2e-179 Leucine-rich repeat (LRR) family protein (.1) Potri.005G234400 [exp] 141 / 1e-41 AT5G66330 412 / 3e-142 Leucine-rich repeat (LRR) family protein (.1) Potri.017G028600 [exp] 48 / 1e-07 AT3G59510 372 / 8e-127 Leucine-rich repeat (LRR) family protein (.1) Potri.017G028400 [exp] 47 / 4e-07 AT3G59510 366 / 6e-124 Leucine-rich repeat (LRR) family protein (.1) Potri.001G301400 [exp] 46 / 5e-07 AT2G15320 429 / 6e-150 Leucine-rich repeat (LRR) family protein (.1) Potri.009G097100 [exp] 44 / 5e-06 AT2G15320 473 / 2e-167 Leucine-rich repeat (LRR) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041809 pacid=23147059 polypeptide=Lus10041809 locus=Lus10041809.g ID=Lus10041809.BGIv1.0 annot-version=v1.0 ATGGCTCTGCTGCCAAAGCTCTCGGCTTTATCGCTCGAGAATAATAAATTCACCGGGGTGATACCGACCCAGTACGCGGTGAAGGCGGTTCTACCTTACG CCGGCGTTTCCCCGTTCGCTAGGCTGTTGCTGGGCGGGAATTACTTGTTCGGACACATACCGGGTCCGCTGATGGGGCTCCGACCCGGAAATTCCAACGT GAGCTTGCACGATAACTGCCTGTACCGGTGCCCGGCGGTGTTGTTCTTCTGCCAGGGAGGAGACCAGAAATCGTTAACAGAGTGTCGGAATTTCCAGCCG TATAATTGA
AA sequence Show only first row Show all	>Lus10041809 pacid=23147059 polypeptide=Lus10041809 locus=Lus10041809.g ID=Lus10041809.BGIv1.0 annot-version=v1.0 MALLPKLSALSLENNKFTGVIPTQYAVKAVLPYAGVSPFARLLLGGNYLFGHIPGPLMGLRPGNSNVSLHDNCLYRCPAVLFFCQGGDQKSLTECRNFQP YN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66330			Leucine-rich repeat (LRR) fami...		Lus10041809 [exp]	0	1
AT2G38550			Transmembrane proteins 14C (.1...		Lus10025221 [exp]	2.6	0.8896
AT1G03440			Leucine-rich repeat (LRR) fami...		Lus10027968 [exp]	11.0	0.8023
AT1G68560		AXY3, TRG1, XYL...	thermoinhibition resistant ger...		Lus10041457 [exp]	12.1	0.8471
AT3G47520		pNAD-MDH, MDH	plastidic NAD-dependent malate...		Lus10034458 [exp]	15.6	0.8356
AT5G24020		ARC11, ATMIND1,...	ACCUMULATION AND REPLICATION O...		Lus10038843 [exp]	17.2	0.8037
AT1G64760			O-Glycosyl hydrolases family 1...		Lus10031098 [exp]	17.4	0.8478
AT4G35730			Regulator of Vps4 activity in ...		Lus10041836 [exp]	29.1	0.8469
AT5G55730		FLA1	FASCICLIN-like arabinogalactan...		Lus10016617 [exp]	29.6	0.8108
					Lus10006225 [exp]	31.7	0.8103
AT2G05920			Subtilase family protein (.1)		Lus10033431 [exp]	36.9	0.8234

Compare expression of checked genes

Lus10041809 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.