Lus10041825 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17650 178 / 6e-54 AMP-dependent synthetase and ligase family protein (.1)
AT1G20560 152 / 4e-45 AAE1 acyl activating enzyme 1 (.1.2)
AT5G16370 121 / 4e-33 AAE5 acyl activating enzyme 5 (.1)
AT5G16340 121 / 5e-33 AMP-dependent synthetase and ligase family protein (.1)
AT1G75960 120 / 1e-32 AMP-dependent synthetase and ligase family protein (.1)
AT1G65880 120 / 2e-32 BZO1 benzoyloxyglucosinolate 1 (.1)
AT1G65890 119 / 2e-32 AAE12 acyl activating enzyme 12 (.1)
AT1G76290 118 / 5e-32 AMP-dependent synthetase and ligase family protein (.1)
AT1G66120 117 / 2e-31 AMP-dependent synthetase and ligase family protein (.1)
AT1G77240 108 / 1e-28 AMP-dependent synthetase and ligase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016011 155 / 1e-45 AT1G20560 846 / 0.0 acyl activating enzyme 1 (.1.2)
Lus10012266 147 / 6e-43 AT5G16370 733 / 0.0 acyl activating enzyme 5 (.1)
Lus10031367 130 / 1e-36 AT1G65890 548 / 0.0 acyl activating enzyme 12 (.1)
Lus10010956 130 / 3e-36 AT1G65890 696 / 0.0 acyl activating enzyme 12 (.1)
Lus10020787 130 / 4e-36 AT1G65890 727 / 0.0 acyl activating enzyme 12 (.1)
Lus10007369 129 / 2e-35 AT1G65890 724 / 0.0 acyl activating enzyme 12 (.1)
Lus10039161 121 / 8e-33 AT5G16370 781 / 0.0 acyl activating enzyme 5 (.1)
Lus10013772 115 / 3e-32 AT5G16340 340 / 9e-115 AMP-dependent synthetase and ligase family protein (.1)
Lus10016869 117 / 2e-31 AT3G16910 902 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G099500 177 / 3e-53 AT2G17650 800 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.005G250700 155 / 2e-45 AT1G20560 790 / 0.0 acyl activating enzyme 1 (.1.2)
Potri.002G010600 153 / 9e-45 AT1G20560 823 / 0.0 acyl activating enzyme 1 (.1.2)
Potri.005G102901 137 / 4e-39 AT1G20560 608 / 0.0 acyl activating enzyme 1 (.1.2)
Potri.007G059401 136 / 1e-38 AT1G20560 594 / 0.0 acyl activating enzyme 1 (.1.2)
Potri.017G138451 128 / 2e-35 AT1G65880 730 / 0.0 benzoyloxyglucosinolate 1 (.1)
Potri.016G034800 128 / 2e-35 AT1G66120 692 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.006G036300 126 / 8e-35 AT1G66120 687 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.017G138350 125 / 2e-34 AT1G65880 724 / 0.0 benzoyloxyglucosinolate 1 (.1)
Potri.004G082000 124 / 7e-34 AT1G65880 724 / 0.0 benzoyloxyglucosinolate 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0378 ANL PF00501 AMP-binding AMP-binding enzyme
Representative CDS sequence
>Lus10041825 pacid=23146896 polypeptide=Lus10041825 locus=Lus10041825.g ID=Lus10041825.BGIv1.0 annot-version=v1.0
ATGCTGTTATCCAACGGGGACATCGGGTTCGAAATCGTTCGACCGAAAAGCAAATTCGATCCGATCAGCGTCAACTACACTTCAGGCACAACATCAAGAC
CCAAGGGAGTCGTGTACAGCCACAGAGGAGCATATCTCAATTCCTTAGCTACACTTTTCCTCCATGAAATCAGCTCCACCCCTGTTTACCTATGGACGGT
TCCTCTGTTCCATTGTAACGGGTGGTGCCTTCCCGGGGGGATTGCAGCTCAAGGAGGCACAAATATCTGCCTCAGAAAGGTCACTCCAAAGGCAATCTTT
GACAACATAGAAATTCAATGTGACTCATTTGGGAGGCGCACCAACCGTGTTGAACATGATCACGAAATCTTGCATTCGCGACCAGAAGCCACTTCCTCAC
AAAGTGAGAGTGGCTAA
AA sequence
>Lus10041825 pacid=23146896 polypeptide=Lus10041825 locus=Lus10041825.g ID=Lus10041825.BGIv1.0 annot-version=v1.0
MLLSNGDIGFEIVRPKSKFDPISVNYTSGTTSRPKGVVYSHRGAYLNSLATLFLHEISSTPVYLWTVPLFHCNGWCLPGGIAAQGGTNICLRKVTPKAIF
DNIEIQCDSFGRRTNRVEHDHEILHSRPEATSSQSESG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17650 AMP-dependent synthetase and l... Lus10041825 0 1
AT2G17650 AMP-dependent synthetase and l... Lus10041826 1.0 0.9942
AT2G28630 KCS12 3-ketoacyl-CoA synthase 12 (.1... Lus10004919 1.4 0.9794
AT1G60010 unknown protein Lus10010708 2.4 0.9528
AT5G07980 dentin sialophosphoprotein-rel... Lus10034692 4.0 0.9092
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10012868 7.5 0.9150
AT5G53880 unknown protein Lus10000796 7.7 0.8925
AT2G02950 PKS1 phytochrome kinase substrate 1... Lus10024228 9.2 0.9030
AT5G13460 IQD11 IQ-domain 11 (.1) Lus10039573 9.5 0.9027
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10012871 9.9 0.9056
AT1G27950 LTPG1 glycosylphosphatidylinositol-a... Lus10006413 10.8 0.9208

Lus10041825 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.