Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17650 126 / 2e-35 AMP-dependent synthetase and ligase family protein (.1) AT1G20560 110 / 5e-30 AAE1 acyl activating enzyme 1 (.1.2) AT3G16910 96 / 2e-24 AAE7, ACN1 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) AT1G66120 90 / 2e-22 AMP-dependent synthetase and ligase family protein (.1) AT1G65880 89 / 4e-22 BZO1 benzoyloxyglucosinolate 1 (.1) AT1G76290 89 / 5e-22 AMP-dependent synthetase and ligase family protein (.1) AT1G65890 89 / 5e-22 AAE12 acyl activating enzyme 12 (.1) AT1G21530 86 / 4e-21 AMP-dependent synthetase and ligase family protein (.1.2) AT5G16370 85 / 1e-20 AAE5 acyl activating enzyme 5 (.1) AT1G75960 85 / 1e-20 AMP-dependent synthetase and ligase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028375 [exp] 157 / 1e-46 AT2G17650 793 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Lus10012266 [exp] 119 / 3e-33 AT5G16370 733 / 0.0 acyl activating enzyme 5 (.1) Lus10016011 [exp] 117 / 2e-32 AT1G20560 846 / 0.0 acyl activating enzyme 1 (.1.2) Lus10020787 [exp] 100 / 2e-26 AT1G65890 727 / 0.0 acyl activating enzyme 12 (.1) Lus10016869 [exp] 99 / 8e-26 AT3G16910 902 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Lus10037734 [exp] 99 / 9e-26 AT3G16910 897 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Lus10007369 [exp] 99 / 1e-25 AT1G65890 724 / 0.0 acyl activating enzyme 12 (.1) Lus10037735 [exp] 99 / 1e-25 AT3G16910 909 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Lus10016870 [exp] 97 / 4e-25 AT3G16910 918 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G099500 [exp] 120 / 2e-33 AT2G17650 800 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.002G010600 [exp] 118 / 1e-32 AT1G20560 823 / 0.0 acyl activating enzyme 1 (.1.2) Potri.005G250700 [exp] 115 / 2e-31 AT1G20560 790 / 0.0 acyl activating enzyme 1 (.1.2) Potri.008G108000 [exp] 101 / 2e-26 AT3G16910 904 / 0.0 ACETATE NON-UTILIZING 1, acyl-activating enzyme 7 (.1) Potri.017G138350 [exp] 98 / 2e-25 AT1G65880 724 / 0.0 benzoyloxyglucosinolate 1 (.1) Potri.017G138451 [exp] 98 / 3e-25 AT1G65880 730 / 0.0 benzoyloxyglucosinolate 1 (.1) Potri.004G082000 [exp] 96 / 1e-24 AT1G65880 724 / 0.0 benzoyloxyglucosinolate 1 (.1) Potri.006G036300 [exp] 89 / 3e-22 AT1G66120 687 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.016G034800 [exp] 89 / 5e-22 AT1G66120 692 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.006G036200 [exp] 87 / 2e-21 AT1G66120 668 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041826 pacid=23146773 polypeptide=Lus10041826 locus=Lus10041826.g ID=Lus10041826.BGIv1.0 annot-version=v1.0 ATGGAAGAATTAGGTTTCCACGTGACTCATTTATACGGCTTAACAGAAGTGTACGGTCCCGCAACTTATTGCGTATGGAAACCCGAATGGGACGATTTAC CTCTCGAAGAGAGGGCATATTTGAAAGCGAGGCAAGGAATGCAGCACGTTGGAATGGAAGATGTCGACGTGAAAAATCCCGAGACGATGAAGTCTGTGCC TCCCGATGGCGAAACTATGGGTGATGAGTGGATATTTAAAGATGTGGAGGCTACTCAGAGGGAATACAGTGATTAG
AA sequence Show only first row Show all	>Lus10041826 pacid=23146773 polypeptide=Lus10041826 locus=Lus10041826.g ID=Lus10041826.BGIv1.0 annot-version=v1.0 MEELGFHVTHLYGLTEVYGPATYCVWKPEWDDLPLEERAYLKARQGMQHVGMEDVDVKNPETMKSVPPDGETMGDEWIFKDVEATQREYSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G17650			AMP-dependent synthetase and l...		Lus10041826 [exp]	0	1
AT2G17650			AMP-dependent synthetase and l...		Lus10041825 [exp]	1.0	0.9942
AT1G60010			unknown protein		Lus10010708 [exp]	1.7	0.9593
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10004919 [exp]	2.0	0.9741
AT5G53880			unknown protein		Lus10000796 [exp]	5.3	0.9028
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10012868 [exp]	7.5	0.9176
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Lus10016398 [exp]	7.9	0.8980
AT5G07980			dentin sialophosphoprotein-rel...		Lus10034692 [exp]	8.9	0.9020
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10012871 [exp]	9.8	0.9089
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10006413 [exp]	10.4	0.9312
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10013614 [exp]	10.5	0.9099

Compare expression of checked genes

Lus10041826 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.