Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12500 119 / 1e-33 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1) AT4G01700 102 / 2e-27 Chitinase family protein (.1) AT1G02360 94 / 2e-24 Chitinase family protein (.1) AT1G05850 53 / 5e-09 CTL1, HOT2, ERH2, ELP1, POM1, ATCTL1 POM-POM1, SENSITIVE TO HOT TEMPERATURES 2, ECTOPIC ROOT HAIR 2, ECTOPIC DEPOSITION OF LIGNIN IN PITH 1, ECTOPIC DEPOSITION OF LIGNIN IN PITH, CHITINASE-LIKE PROTEIN 1, Chitinase family protein (.1) AT2G43620 50 / 3e-08 Chitinase family protein (.1) AT2G43610 49 / 1e-07 Chitinase family protein (.1) AT3G54420 48 / 2e-07 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) AT1G56680 48 / 2e-07 Chitinase family protein (.1) AT2G43570 42 / 3e-05 CHI "chitinase, putative", chitinase, putative (.1) AT3G16920 42 / 5e-05 ATCTL2 chitinase-like protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041830 [exp] 156 / 8e-48 AT3G12500 402 / 4e-141 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10028377 [exp] 145 / 1e-43 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10028378 [exp] 105 / 3e-30 AT3G12500 113 / 4e-31 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10009968 [exp] 106 / 8e-29 AT1G02360 409 / 1e-145 Chitinase family protein (.1) Lus10038026 [exp] 101 / 6e-27 AT1G02360 412 / 9e-147 Chitinase family protein (.1) Lus10010861 [exp] 65 / 2e-13 AT2G43590 263 / 6e-89 Chitinase family protein (.1) Lus10010862 [exp] 65 / 2e-13 AT2G43590 262 / 1e-88 Chitinase family protein (.1) Lus10024368 [exp] 63 / 1e-12 AT2G43590 264 / 2e-89 Chitinase family protein (.1) Lus10032794 [exp] 57 / 1e-10 AT2G43590 265 / 6e-90 Chitinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G182000 [exp] 129 / 1e-37 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G141700 [exp] 124 / 3e-35 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142150 [exp] 117 / 9e-34 AT3G12500 365 / 8e-128 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142300 [exp] 110 / 3e-30 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.014G111800 [exp] 106 / 4e-29 AT4G01700 422 / 1e-150 Chitinase family protein (.1) Potri.002G186500 [exp] 102 / 2e-27 AT1G02360 413 / 2e-147 Chitinase family protein (.1) Potri.009G141800 [exp] 103 / 3e-27 AT3G12500 351 / 9e-121 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142000 [exp] 92 / 5e-23 AT3G12500 346 / 6e-119 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.004G182100 [exp] 76 / 3e-17 AT3G12500 306 / 7e-103 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.013G125000 [exp] 55 / 1e-09 AT3G54420 421 / 1e-150 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0037 [flax] [poplar] Lysozyme PF00182 [flax] [poplar] Glyco_hydro_19 Chitinase class I
Representative CDS sequence Show only first row Show all	>Lus10041829 pacid=23146846 polypeptide=Lus10041829 locus=Lus10041829.g ID=Lus10041829.BGIv1.0 annot-version=v1.0 ATGCGCAAGCACCGTAATGACGGTGCTTGCGAGGTTAGCAGGTTCTACAGCTATGATGCTTTCATCGCTGTTGCTCGGTGCATCAACGGATTTGGCACAA CCGGTGATCTCAACACCCGTAAAAAAGAGCACGCCGCTTTCTTGGCCCAGACCTCCCACGAAACCACCGGAGGATGGCCAACGGCACCTGACGGCGAATT TGCGTGGGGTGTTGTTTCATTAGAGAGGGATCGTTCAACTTATTGCACAATACCTAACGAATGCCCATGCGCTGCTGACAAGCAATACTACGACAGAGGA CTCATCCAGCTCACTCCGATTGGGTTCCACCAGAGGTTCAGCTCCATTCTCGGAGTCAACCCTGGCGGCAAGCAACAATCAAACCCCCTTCAATAA
AA sequence Show only first row Show all	>Lus10041829 pacid=23146846 polypeptide=Lus10041829 locus=Lus10041829.g ID=Lus10041829.BGIv1.0 annot-version=v1.0 MRKHRNDGACEVSRFYSYDAFIAVARCINGFGTTGDLNTRKKEHAAFLAQTSHETTGGWPTAPDGEFAWGVVSLERDRSTYCTIPNECPCAADKQYYDRG LIQLTPIGFHQRFSSILGVNPGGKQQSNPLQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10041829 [exp]	0	1
AT5G51105			Protein of unknown function (D...		Lus10043285 [exp]	7.1	0.9215
AT1G21130		IGMT4	indole glucosinolate O-methylt...		Lus10030187 [exp]	10.5	0.9143
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10009129 [exp]	12.8	0.9054
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10017677 [exp]	12.8	0.8503
AT2G32460	MYB	ATMYB101, AtM1	ARABIDOPSIS THALIANA MYB 1, my...		Lus10035275 [exp]	13.1	0.8132
AT5G09500			Ribosomal protein S19 family p...		Lus10026127 [exp]	13.2	0.8127
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10030174 [exp]	13.7	0.7940
AT1G74460			GDSL-like Lipase/Acylhydrolase...		Lus10021664 [exp]	13.9	0.8385
AT4G39670			Glycolipid transfer protein (G...		Lus10035024 [exp]	14.1	0.8526
					Lus10007780 [exp]	16.4	0.8560

Compare expression of checked genes

Lus10041829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.