Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12500 192 / 9e-62 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1) AT4G01700 159 / 2e-49 Chitinase family protein (.1) AT1G02360 155 / 5e-48 Chitinase family protein (.1) AT3G16920 103 / 1e-27 ATCTL2 chitinase-like protein 2 (.1) AT1G05850 99 / 7e-26 CTL1, HOT2, ERH2, ELP1, POM1, ATCTL1 POM-POM1, SENSITIVE TO HOT TEMPERATURES 2, ECTOPIC ROOT HAIR 2, ECTOPIC DEPOSITION OF LIGNIN IN PITH 1, ECTOPIC DEPOSITION OF LIGNIN IN PITH, CHITINASE-LIKE PROTEIN 1, Chitinase family protein (.1) AT2G43590 82 / 8e-20 Chitinase family protein (.1) AT3G54420 78 / 4e-18 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1) AT2G43580 74 / 9e-17 Chitinase family protein (.1) AT2G43610 73 / 3e-16 Chitinase family protein (.1) AT2G43620 72 / 3e-16 Chitinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000193 [exp] 245 / 2e-85 AT3G12500 191 / 2e-61 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10028377 [exp] 243 / 8e-82 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10041830 [exp] 241 / 3e-81 AT3G12500 402 / 4e-141 PATHOGENESIS-RELATED 3, basic chitinase (.1) Lus10038026 [exp] 154 / 2e-47 AT1G02360 412 / 9e-147 Chitinase family protein (.1) Lus10009968 [exp] 152 / 1e-46 AT1G02360 409 / 1e-145 Chitinase family protein (.1) Lus10016872 [exp] 109 / 8e-31 AT3G16920 354 / 5e-124 chitinase-like protein 2 (.1) Lus10037737 [exp] 109 / 1e-29 AT3G16920 499 / 2e-179 chitinase-like protein 2 (.1) Lus10037428 [exp] 103 / 2e-27 AT1G05850 489 / 1e-175 POM-POM1, SENSITIVE TO HOT TEMPERATURES 2, ECTOPIC ROOT HAIR 2, ECTOPIC DEPOSITION OF LIGNIN IN PITH 1, ECTOPIC DEPOSITION OF LIGNIN IN PITH, CHITINASE-LIKE PROTEIN 1, Chitinase family protein (.1) Lus10041278 [exp] 98 / 3e-25 AT1G05850 504 / 0.0 POM-POM1, SENSITIVE TO HOT TEMPERATURES 2, ECTOPIC ROOT HAIR 2, ECTOPIC DEPOSITION OF LIGNIN IN PITH 1, ECTOPIC DEPOSITION OF LIGNIN IN PITH, CHITINASE-LIKE PROTEIN 1, Chitinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G182000 [exp] 185 / 4e-59 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G141700 [exp] 182 / 2e-58 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142150 [exp] 180 / 2e-58 AT3G12500 365 / 8e-128 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.002G186500 [exp] 160 / 3e-50 AT1G02360 413 / 2e-147 Chitinase family protein (.1) Potri.014G111800 [exp] 152 / 4e-47 AT4G01700 422 / 1e-150 Chitinase family protein (.1) Potri.009G141800 [exp] 150 / 2e-45 AT3G12500 351 / 9e-121 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142300 [exp] 149 / 3e-45 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.009G142000 [exp] 145 / 8e-44 AT3G12500 346 / 6e-119 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.004G182100 [exp] 135 / 2e-39 AT3G12500 306 / 7e-103 PATHOGENESIS-RELATED 3, basic chitinase (.1) Potri.010G141600 [exp] 110 / 4e-30 AT3G16920 458 / 4e-163 chitinase-like protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0037 [flax] [poplar] Lysozyme PF00182 [flax] [poplar] Glyco_hydro_19 Chitinase class I
Representative CDS sequence Show only first row Show all	>Lus10041831 pacid=23147070 polypeptide=Lus10041831 locus=Lus10041831.g ID=Lus10041831.BGIv1.0 annot-version=v1.0 ATGGTCAGCAACTACAACTACGGGCAAGCGGGCAGGGCAATTGGGCAGGACCTGATTAACAACCCGGATTTGGTGGCCACCAACGCCGAGATATCATTTC GAACGGCGATTTGGTTCTGGATGACTCCTCAGTCCAACAAGCCGTCCATCCATAGCGTGATTGTCGGGCAGTGGAATCCGTCGGCGACCCACAGGGCGGC CAACAGAGTTCCCGGGTACGGGGTCATCACCAACATTATCAACGGCGGTCTGGAATGTGGTCGCGGGGCCGACCCACGTGTGGCTAATAGGATTGGGTTC TACCAGAGGTACTGCTCCATTCTCGGAGTCAACCCTGGCGGCAACCTTGACTGCAACAATCAAACCCCCTTTGCCTAA
AA sequence Show only first row Show all	>Lus10041831 pacid=23147070 polypeptide=Lus10041831 locus=Lus10041831.g ID=Lus10041831.BGIv1.0 annot-version=v1.0 MVSNYNYGQAGRAIGQDLINNPDLVATNAEISFRTAIWFWMTPQSNKPSIHSVIVGQWNPSATHRAANRVPGYGVITNIINGGLECGRGADPRVANRIGF YQRYCSILGVNPGGNLDCNNQTPFA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Lus10041831 [exp]	0	1
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Lus10000326 [exp]	1.0	0.9560
AT5G28470			Major facilitator superfamily ...		Lus10042182 [exp]	3.2	0.9191
					Lus10010270 [exp]	3.7	0.9560
AT3G05670			RING/U-box protein (.1)		Lus10007973 [exp]	8.5	0.9204
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10031235 [exp]	8.7	0.9349
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10014227 [exp]	9.8	0.9236
AT5G45020			Glutathione S-transferase fami...		Lus10026012 [exp]	10.2	0.9361
AT4G05230			Ubiquitin-like superfamily pro...		Lus10007641 [exp]	10.2	0.9253
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015746 [exp]	15.4	0.8826
AT2G33420			Protein of unknown function (D...		Lus10011785 [exp]	17.3	0.9172

Compare expression of checked genes

Lus10041831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.