Lus10041843 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35770 181 / 1e-58 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
AT5G66040 166 / 1e-53 STR16 sulfurtransferase protein 16 (.1.2)
AT5G66170 112 / 4e-32 STR18 sulfurtransferase 18 (.1.2.3)
AT2G21045 99 / 1e-26 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G17850 89 / 1e-22 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G27700 60 / 3e-11 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G24750 44 / 3e-05 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G42220 39 / 0.0008 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028390 268 / 8e-93 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Lus10005635 157 / 4e-49 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2)
Lus10041525 146 / 5e-43 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10012566 140 / 9e-43 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2)
Lus10041895 91 / 5e-23 AT5G66170 116 / 3e-33 sulfurtransferase 18 (.1.2.3)
Lus10028442 89 / 3e-22 AT5G66170 119 / 2e-34 sulfurtransferase 18 (.1.2.3)
Lus10041894 88 / 3e-22 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3)
Lus10021227 84 / 1e-20 AT5G66040 73 / 4e-17 sulfurtransferase protein 16 (.1.2)
Lus10028441 68 / 1e-14 AT5G66170 89 / 9e-24 sulfurtransferase 18 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G106400 210 / 3e-69 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.002G014900 163 / 2e-51 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.014G131300 113 / 3e-32 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.005G111200 106 / 2e-29 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.012G020700 58 / 3e-10 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G008000 54 / 8e-09 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.006G100600 50 / 1e-07 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.006G059200 45 / 9e-06 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Lus10041843 pacid=23146951 polypeptide=Lus10041843 locus=Lus10041843.g ID=Lus10041843.BGIv1.0 annot-version=v1.0
ATGGAATCCTGCAGATCAATTGTTTCGTCCAGTACTGCTGGTTTGACCGCCGCTTCGCTTGCTCCGCTTCTTCACCTTCCTTCAAATGTGAAAGTCTTCT
CCAGGGTACAATCTCATTCCCAGTTGAGGAAAATACCAATTACTAACAGCAGGAGGAGGATCTCAAGATTCTGCACGAAGGCGGTGGTGGGGGAGAACTT
GAATGCGGCAGCCGTTCCGACATCAGTGCCAGTAAGAGTAGCGTATGAACTTCTGCTAGCTGGGCATCGCTACCTTGATGTCAGGACACCGGAAGAGTTC
AGCGCAGGACACCCAGAAGGAGCAGTCAATGTTCCTTACATGTATAGAGTTGGTTCAGGTTTGGCAAAGAACCCAAAATTTGTAGAGCAAGTTTCATCAC
AGTTTGGCAAGTACAATGAGATCATTGTTGGTTGTCAGCTGGGGAAAAGGTCTATGATGGCGGCAACTGATCTTTTAGCTGCCGGTTTTATGGCAGTGAC
AGACATAGCGGGCGGGTATGCAGCTTGGACGCAGAATGACCTCCCGACTGAGAAGTAA
AA sequence
>Lus10041843 pacid=23146951 polypeptide=Lus10041843 locus=Lus10041843.g ID=Lus10041843.BGIv1.0 annot-version=v1.0
MESCRSIVSSSTAGLTAASLAPLLHLPSNVKVFSRVQSHSQLRKIPITNSRRRISRFCTKAVVGENLNAAAVPTSVPVRVAYELLLAGHRYLDVRTPEEF
SAGHPEGAVNVPYMYRVGSGLAKNPKFVEQVSSQFGKYNEIIVGCQLGKRSMMAATDLLAAGFMAVTDIAGGYAAWTQNDLPTEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G35770 ATSEN1, DIN1, S... SENESCENCE ASSOCIATED GENE 1, ... Lus10041843 0 1
AT4G35770 ATSEN1, DIN1, S... SENESCENCE ASSOCIATED GENE 1, ... Lus10028390 1.0 0.9752
AT4G33580 ATBCA5 A. THALIANA BETA CARBONIC ANHY... Lus10015892 2.0 0.9606
AT5G27830 unknown protein Lus10029881 2.4 0.9585
Lus10028391 3.5 0.9391
AT5G38900 Thioredoxin superfamily protei... Lus10005082 5.7 0.9392
AT1G10070 ATBCAT-2 branched-chain amino acid tran... Lus10028246 6.0 0.9471
AT3G01640 ATGLCAK ARABIDOPSIS THALIANA GLUCURONO... Lus10022282 7.7 0.9577
AT5G20950 Glycosyl hydrolase family prot... Lus10013646 7.7 0.9368
AT5G20950 Glycosyl hydrolase family prot... Lus10010656 8.4 0.9489
AT3G17940 Galactose mutarotase-like supe... Lus10010976 8.5 0.9132

Lus10041843 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.