Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51380 45 / 3e-07 IQD20 IQ-domain 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028391 [exp] 0 / 1 ND 78 / 1e-19
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G106300 [exp] 47 / 1e-07 AT3G51380 85 / 2e-22 IQ-domain 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00612 [flax] [poplar] IQ IQ calmodulin-binding motif
Representative CDS sequence Show only first row Show all	>Lus10041844 pacid=23146802 polypeptide=Lus10041844 locus=Lus10041844.g ID=Lus10041844.BGIv1.0 annot-version=v1.0 ATGAGGATGCCTAAGAACTGGTTTAGCAGGATCGGAAGAAAGCTCCTGAGTCGCCGATCCTACGGAGAACGAGACGCTGTCATCCTCCAATCCAATGCCG CCTGCAATACCTTGGACATGGACGACACAAAAGCTCCGCTAGCTTCAAACAATCTAGCATTGGCAGCAATCAAGATCCAAGCCACTTTCAGGGCTCACCT GGCAAGGCGAGCATTTCGAGCACTCAGAAGCTTGGTGAAGGTGCAAGCGCTGGCTCGAGGGGTGTACGTCAGAAGACAGTCTCAGATAGCTCTTCATTGT ATGTGTGCCCTTGTCCGGTTGCAGGTCAGAGTTCGTGCCAGACAGCTCTTGGCAAGATGTACTGATGAGTGA
AA sequence Show only first row Show all	>Lus10041844 pacid=23146802 polypeptide=Lus10041844 locus=Lus10041844.g ID=Lus10041844.BGIv1.0 annot-version=v1.0 MRMPKNWFSRIGRKLLSRRSYGERDAVILQSNAACNTLDMDDTKAPLASNNLALAAIKIQATFRAHLARRAFRALRSLVKVQALARGVYVRRQSQIALHC MCALVRLQVRVRARQLLARCTDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51380		IQD20	IQ-domain 20 (.1)		Lus10041844 [exp]	0	1
AT1G64060		RBOHAP108, ATRB...	ARABIDOPSIS THALIANA RESPIRATO...		Lus10028755 [exp]	1.4	0.8107
AT2G34930			disease resistance family prot...		Lus10024737 [exp]	2.8	0.7894
AT2G46490			unknown protein		Lus10040009 [exp]	8.5	0.7433
AT4G10770		ATOPT7	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10003217 [exp]	12.5	0.7839
AT4G38430		ATROPGEF1, ROPG...	rho guanyl-nucleotide exchange...		Lus10005644 [exp]	13.4	0.7101
AT4G21215			unknown protein		Lus10020063 [exp]	14.1	0.7775
AT2G38010			Neutral/alkaline non-lysosomal...		Lus10017188 [exp]	14.5	0.7893
AT4G17720			RNA-binding (RRM/RBD/RNP motif...		Lus10030952 [exp]	15.8	0.7315
AT4G33950		ATOST1, P44, SR...	SNF1-RELATED PROTEIN KINASE 2....		Lus10004748 [exp]	16.1	0.7929
AT5G58350		ZIK2, WNK4	with no lysine (K) kinase 4 (....		Lus10042223 [exp]	19.5	0.8007

Compare expression of checked genes

Lus10041844 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.