Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35905 114 / 2e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028420 [exp] 169 / 7e-57 AT4G35905 114 / 3e-35 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF03966 [flax] [poplar] Trm112p Trm112p-like protein
Representative CDS sequence Show only first row Show all	>Lus10041873 pacid=23146912 polypeptide=Lus10041873 locus=Lus10041873.g ID=Lus10041873.BGIv1.0 annot-version=v1.0 ATGGTGAGGTTGGGGAAAGCGATGCTGAAAGAAGCTGCTAATGGAATCGGGAAAACACTTTCCGAAGCTCTAGTCTGCCCACTCTCCAAGCAACCCTTAA GGTACTGTAAGGAAACCAATTCCCTTATCAGCGACTCCATTGGCGTCTCTTTTCCTATAAAGGATGGGATACCTTGCTTGGTACCTCGAGATGGGAAGAT ACTTGAAGCTGCCGATGATAACCATGGGGATCCAGCTACAACTCACTGA
AA sequence Show only first row Show all	>Lus10041873 pacid=23146912 polypeptide=Lus10041873 locus=Lus10041873.g ID=Lus10041873.BGIv1.0 annot-version=v1.0 MVRLGKAMLKEAANGIGKTLSEALVCPLSKQPLRYCKETNSLISDSIGVSFPIKDGIPCLVPRDGKILEAADDNHGDPATTH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35905			unknown protein		Lus10041873 [exp]	0	1
AT4G31720		STG1, TAFII15, ...	TBP-ASSOCIATED FACTOR 10, SALT...		Lus10034375 [exp]	3.5	0.9212
AT4G35980			unknown protein		Lus10028436 [exp]	5.0	0.9038
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042905 [exp]	5.8	0.9184
AT5G13150		ATEXO70C1	exocyst subunit exo70 family p...		Lus10037048 [exp]	9.2	0.9104
AT3G55005		TON1B	tonneau 1b (TON1b) (.1)		Lus10023478 [exp]	9.8	0.8908
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10025309 [exp]	12.6	0.9002
AT5G54140		ILL3	IAA-leucine-resistant (ILR1)-l...		Lus10015388 [exp]	13.0	0.9007
AT3G05580		TOPP9	type one protein phosphatase 9...		Lus10031489 [exp]	15.7	0.8942
AT1G59520		CW7	CW7 (.1.2.3)		Lus10012485 [exp]	15.8	0.8743
AT2G36410			Family of unknown function (DU...		Lus10027724 [exp]	17.8	0.8585

Compare expression of checked genes

Lus10041873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.