Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38580 229 / 3e-78 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT5G66110 219 / 2e-74 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 199 / 1e-66 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 160 / 4e-51 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 156 / 1e-49 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 147 / 5e-46 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 142 / 5e-44 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G08570 130 / 4e-39 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 93 / 1e-24 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 82 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028426 [exp] 329 / 9e-118 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10019789 [exp] 213 / 6e-72 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10014120 [exp] 213 / 9e-72 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10042946 [exp] 166 / 2e-53 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 165 / 8e-53 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 162 / 5e-52 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 159 / 2e-50 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 157 / 8e-50 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10009115 [exp] 155 / 5e-49 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G175400 [exp] 223 / 7e-76 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 218 / 4e-74 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 217 / 2e-73 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 172 / 6e-56 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 169 / 2e-54 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 158 / 2e-50 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.005G079800 [exp] 157 / 8e-50 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G135201 [exp] 151 / 4e-48 AT4G38580 167 / 8e-55 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G167000 [exp] 151 / 1e-47 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 145 / 3e-45 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10041879 pacid=23146605 polypeptide=Lus10041879 locus=Lus10041879.g ID=Lus10041879.BGIv1.0 annot-version=v1.0 ATGGGTATCCTCGACCACTTCTCTGAGCTCTGCGACTCCAGCCACCACCATGACAGCAAGAAGTACAAACGCAAGCAGCTCCAGACGGTGGAGATCAAGA TAAAGATCGACTGCGAAGGGTGCGAGAGGAAAGTGAGGAAATCCGTGGAAGGGATGAAAGGCGTGACTCAAGTGGATGTGAACCCCAAGCAGCACAAGCT GACTGTAACGGGCTACGTTGACGCGAACAAGGTTTTGCACCGGGTCCGTCACCGCACCGGTAAGCACGCGGATCTGTGGCCTTATGTTCCGTACGACGTC GTTGAGCACCCTTACGCTCCCGGCGCGTACGATAAGAAGGCACCTGCTGGTTATGTGAGGAACGTGATGAACGACCCGCAGGCGTCGGCTCTTGCACGCG CCACGTCGTTCGAGGTCAGGACTACCACCGCCTTTAGCGACGAGAATCCCAACGCCTGCTCGGTGATGTGA
AA sequence Show only first row Show all	>Lus10041879 pacid=23146605 polypeptide=Lus10041879 locus=Lus10041879.g ID=Lus10041879.BGIv1.0 annot-version=v1.0 MGILDHFSELCDSSHHHDSKKYKRKQLQTVEIKIKIDCEGCERKVRKSVEGMKGVTQVDVNPKQHKLTVTGYVDANKVLHRVRHRTGKHADLWPYVPYDV VEHPYAPGAYDKKAPAGYVRNVMNDPQASALARATSFEVRTTTAFSDENPNACSVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Lus10041879 [exp]	0	1
AT1G55265			Protein of unknown function, D...		Lus10039182 [exp]	1.0	0.9070
AT2G20740			Tetraspanin family protein (.1...		Lus10018584 [exp]	3.2	0.9026
AT5G19070			SNARE associated Golgi protein...		Lus10004421 [exp]	5.2	0.8958
AT4G21215			unknown protein		Lus10018373 [exp]	5.7	0.8572
AT4G31860			Protein phosphatase 2C family ...		Lus10042416 [exp]	8.5	0.8672
AT3G20340			unknown protein		Lus10021518 [exp]	8.9	0.8362
AT5G07120		SNX2b	sorting nexin 2B (.1)		Lus10042247 [exp]	13.7	0.8633
AT5G19860			Protein of unknown function, D...		Lus10039187 [exp]	15.5	0.7921
AT5G01520		AtAIRP2, AIRP2	ABA Insensitive RING Protein 2...		Lus10004821 [exp]	15.9	0.8532
AT1G60940		SNRK2-10, SNRK2...	SNF1-RELATED KINASE 2B, SUCROS...		Lus10001367 [exp]	16.8	0.8635

Compare expression of checked genes

Lus10041879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.