Lus10041883 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66130 63 / 3e-12 ATRAD17 RADIATION SENSITIVE 17 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028430 130 / 4e-36 AT5G66130 532 / 0.0 RADIATION SENSITIVE 17 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G111000 110 / 8e-29 AT5G66130 607 / 0.0 RADIATION SENSITIVE 17 (.1)
PFAM info
Representative CDS sequence
>Lus10041883 pacid=23146984 polypeptide=Lus10041883 locus=Lus10041883.g ID=Lus10041883.BGIv1.0 annot-version=v1.0
ATGCTCAGAACTCTCTTGGGCCAAACAACACGGGTCCAGAAGTTCCATCAGCTTGCATCGTTCTCTTTGCTGCTCCTCACTCTCTCTACACAAAACCAGA
GTGCGCCATTTCTCTCTTCTAGATTTGTACATTTACAGTCAAGTAGTTCATGGGTTTCTGTTGAATTGATATTTCTGGCTCCATTTCATGCACGCTATTC
TTTTGCAGTTTTAGATTTCATAAGTGATGAAGCGACGGATGATGCCTCAGATGTTGCCGCTTATTTAAGCGATGCAGACATGCTCCTTTCTTCCTTCCGA
GGACAGCTGGCCAGATACAACGAGGCGGAGAATGTTCTTCAGTCAGCTGCTGCATCAGTCGCTTGTCGTGGTGCGCTCTTTGGGAATTCTCATCCTTCAC
CTCGCATGTCATTATTGTATGCTCCAAGCAGTTTGATGTAG
AA sequence
>Lus10041883 pacid=23146984 polypeptide=Lus10041883 locus=Lus10041883.g ID=Lus10041883.BGIv1.0 annot-version=v1.0
MLRTLLGQTTRVQKFHQLASFSLLLLTLSTQNQSAPFLSSRFVHLQSSSSWVSVELIFLAPFHARYSFAVLDFISDEATDDASDVAAYLSDADMLLSSFR
GQLARYNEAENVLQSAAASVACRGALFGNSHPSPRMSLLYAPSSLM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66130 ATRAD17 RADIATION SENSITIVE 17 (.1) Lus10041883 0 1
AT3G57930 unknown protein Lus10031806 5.6 0.8724
AT1G70830 MLP28 MLP-like protein 28 (.1.2.3.4.... Lus10012466 9.8 0.8213
AT1G14930 Polyketide cyclase/dehydrase a... Lus10042490 10.7 0.8492
AT5G22340 unknown protein Lus10043400 22.0 0.8595
AT5G64250 Aldolase-type TIM barrel famil... Lus10006545 24.7 0.8344
AT4G02725 unknown protein Lus10014675 26.2 0.8579
AT5G22340 unknown protein Lus10034185 30.2 0.8554
AT3G09870 SAUR-like auxin-responsive pro... Lus10013819 30.6 0.8346
Lus10033439 33.7 0.8039
AT1G80245 Spc97 / Spc98 family of spindl... Lus10040637 34.2 0.7542

Lus10041883 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.