Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35980 141 / 1e-45 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028436 [exp] 177 / 5e-60 AT4G35980 139 / 9e-45 unknown protein Lus10009388 [exp] 84 / 4e-23 AT4G35980 66 / 3e-16 unknown protein Lus10042598 [exp] 83 / 3e-21 AT4G35980 71 / 3e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G111900 [exp] 151 / 9e-50 AT4G35980 139 / 5e-45 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041889 pacid=23146621 polypeptide=Lus10041889 locus=Lus10041889.g ID=Lus10041889.BGIv1.0 annot-version=v1.0 ATGAAGGAATACGAGATTGAAGAGAAAAAGCAAGCTGCAGCTGATGTATTGTTCCACTACTCCAAGTTTGTGATGACTTGTATTGGGAACCAAGTTCGCC CCTGTGACATGAGGCTGCATCTGATGAAGGAGATATCAGGAATCCCAACTTCTCTCAAGAAGGAACCTTCTCAGATGGCTGCCTCGCCCGATGTGATGGG TGAATCGTCGAGCTCAGGTACTGCTAGACTTGATAAAACAGACAGCTTTCGTGCACTTTAG
AA sequence Show only first row Show all	>Lus10041889 pacid=23146621 polypeptide=Lus10041889 locus=Lus10041889.g ID=Lus10041889.BGIv1.0 annot-version=v1.0 MKEYEIEEKKQAAADVLFHYSKFVMTCIGNQVRPCDMRLHLMKEISGIPTSLKKEPSQMAASPDVMGESSSSGTARLDKTDSFRAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35980			unknown protein		Lus10041889 [exp]	0	1
AT5G09830			BolA-like family protein (.1)		Lus10020861 [exp]	1.7	0.8879
AT3G27050			unknown protein		Lus10035208 [exp]	2.4	0.8682
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030583 [exp]	2.4	0.8857
AT4G05000		VPS28-2, VPS28-...	vacuolar protein sorting-assoc...		Lus10018442 [exp]	2.8	0.8774
AT1G60430		ARPC3	actin-related protein C3 (.1.2...		Lus10006335 [exp]	4.2	0.8562
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Lus10019084 [exp]	4.6	0.8670
AT2G45530			RING/U-box superfamily protein...		Lus10000211 [exp]	5.5	0.8477
AT2G44360			unknown protein		Lus10012711 [exp]	6.0	0.8461
AT5G08290		YLS8	YELLOW-LEAF-SPECIFIC GENE 8, m...		Lus10017390 [exp]	6.7	0.8697
AT1G79390			unknown protein		Lus10001838 [exp]	6.8	0.8363

Compare expression of checked genes

Lus10041889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.