Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66170 120 / 2e-35 STR18 sulfurtransferase 18 (.1.2.3) AT2G17850 108 / 1e-30 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT2G21045 102 / 7e-28 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) AT5G66040 94 / 3e-25 STR16 sulfurtransferase protein 16 (.1.2) AT4G35770 90 / 5e-23 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) AT4G27700 59 / 4e-11 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028441 [exp] 229 / 6e-79 AT5G66170 89 / 9e-24 sulfurtransferase 18 (.1.2.3) Lus10041895 [exp] 169 / 5e-54 AT5G66170 116 / 3e-33 sulfurtransferase 18 (.1.2.3) Lus10028442 [exp] 166 / 1e-52 AT5G66170 119 / 2e-34 sulfurtransferase 18 (.1.2.3) Lus10028390 [exp] 93 / 2e-24 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10041843 [exp] 89 / 1e-22 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Lus10012566 [exp] 85 / 2e-21 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2) Lus10005635 [exp] 83 / 3e-20 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2) Lus10041525 [exp] 81 / 2e-18 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4) Lus10023243 [exp] 56 / 6e-10 AT4G27700 305 / 7e-106 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G111200 [exp] 128 / 2e-38 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.014G131300 [exp] 112 / 2e-32 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.002G014900 [exp] 92 / 8e-24 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.005G106400 [exp] 93 / 1e-23 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3) Potri.012G020700 [exp] 49 / 1e-07 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G008000 [exp] 49 / 2e-07 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.006G100600 [exp] 47 / 7e-07 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.015G086100 [exp] 39 / 0.0009 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [flax] [poplar] Phosphatase PF00581 [flax] [poplar] Rhodanese Rhodanese-like domain
Representative CDS sequence Show only first row Show all	>Lus10041894 pacid=23146805 polypeptide=Lus10041894 locus=Lus10041894.g ID=Lus10041894.BGIv1.0 annot-version=v1.0 ATGGCTTCACCATCTCAGGACAAAAGTTCAGGAGGAGCAGAGGAAGTTCCAACCATCGACGTTCACAAGGCCAAGTCTCTGATCGAGTCCGGCCACGTCT ATCTTGATGTCAGAATGGAGGAGGATTTCAGCGCAGCACATGCTGATGTAGACACGGTCTGGAAACAAAGAGCGCAGCTGGTTGCTGAGACTGCTGATGA TGATATCCCGAAGATCTACAATGTTGCTTACTATGTCTACGCGCCTCAAGGCAGAGTGAAGAATCCCCAGTTCTTGGAGGAAGTCAGGAAGATTTTCAAG GATGACGACCATCTCGTCGTGGGGTGCGGCACTGGTGGGAGATCTTGTTTGGCAACTGCTGATCTTCTGACTGCAGGTATGAAGAATGTTAACAACTTGG GAGGAGGGTACCGGGCTTGGGAAAAGAATGGGTTCCCTGTGATTAAACAGCTAAAGGAACAACAACCCATCTGA
AA sequence Show only first row Show all	>Lus10041894 pacid=23146805 polypeptide=Lus10041894 locus=Lus10041894.g ID=Lus10041894.BGIv1.0 annot-version=v1.0 MASPSQDKSSGGAEEVPTIDVHKAKSLIESGHVYLDVRMEEDFSAAHADVDTVWKQRAQLVAETADDDIPKIYNVAYYVYAPQGRVKNPQFLEEVRKIFK DDDHLVVGCGTGGRSCLATADLLTAGMKNVNNLGGGYRAWEKNGFPVIKQLKEQQPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66170		STR18	sulfurtransferase 18 (.1.2.3)		Lus10041894 [exp]	0	1
AT2G26230			uricase / urate oxidase / nodu...		Lus10008952 [exp]	1.7	0.9376
AT4G03420			Protein of unknown function (D...		Lus10018572 [exp]	3.5	0.9131
AT3G24120	GARP		Homeodomain-like superfamily p...		Lus10038735 [exp]	5.7	0.9135
					Lus10012067 [exp]	8.4	0.9063
AT5G14420		RGLG2	RING domain ligase2 (.1.2.3.4)		Lus10000144 [exp]	12.4	0.9234
AT1G34780		ATAPRL4	APR-like 4 (.1.2)		Lus10036486 [exp]	14.8	0.9131
AT3G01850			Aldolase-type TIM barrel famil...		Lus10035219 [exp]	15.1	0.9170
AT5G52830	WRKY	ATWRKY27, WRKY2...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10027538 [exp]	15.2	0.8919
AT5G66170		STR18	sulfurtransferase 18 (.1.2.3)		Lus10041895 [exp]	16.5	0.8854
AT1G76360			Protein kinase superfamily pro...		Lus10012256 [exp]	17.3	0.9114

Compare expression of checked genes

Lus10041894 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.