Lus10041895 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66170 116 / 2e-33 STR18 sulfurtransferase 18 (.1.2.3)
AT2G17850 103 / 4e-28 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G21045 99 / 4e-26 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT5G66040 88 / 2e-22 STR16 sulfurtransferase protein 16 (.1.2)
AT4G35770 86 / 4e-21 ATSEN1, DIN1, SEN1 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
AT4G27700 46 / 4e-06 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G42220 41 / 0.0002 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028442 330 / 1e-116 AT5G66170 119 / 2e-34 sulfurtransferase 18 (.1.2.3)
Lus10041894 159 / 1e-49 AT5G66170 120 / 1e-35 sulfurtransferase 18 (.1.2.3)
Lus10028441 117 / 9e-34 AT5G66170 89 / 9e-24 sulfurtransferase 18 (.1.2.3)
Lus10028390 95 / 2e-24 AT4G35770 182 / 3e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Lus10041843 91 / 6e-23 AT4G35770 182 / 6e-59 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Lus10012566 84 / 1e-20 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2)
Lus10005635 82 / 2e-19 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2)
Lus10041525 77 / 1e-16 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10023820 42 / 0.0001 AT2G42220 302 / 1e-104 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G111200 139 / 5e-42 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.014G131300 116 / 3e-33 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.002G014900 94 / 3e-24 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.005G106400 90 / 6e-22 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.006G059200 43 / 7e-05 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G086100 42 / 9e-05 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.006G100600 41 / 0.0002 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Lus10041895 pacid=23146703 polypeptide=Lus10041895 locus=Lus10041895.g ID=Lus10041895.BGIv1.0 annot-version=v1.0
ATGGCTACAGTTTCTCTTCTCCGATGGAATTTCTTGTTGTTGTTGTTGTTGCTTTCGGTTTCCCGTTGGGTTTGCTACAGTTCTGGAGCTGAAGTAACCA
CCGTTGATGTTCATAAGGCCAAGTCTCTTCTCCAGTCCGGCCATGTCTATCTTGATGTCAGGACAGAGGAGGAGTTCAAAGCAGCGCATCCTGACGCGGA
GACGATATGGAAACTGAGAGGACAACCTGAGAAAGAAACTGATGATGATGTCACAAAGAAGAAGAAGATCATATACAATATTCCTTACATGTTCAACACG
TCTCAGGGTCCTCGTTTCCGCTTCTGTCTGATTCATTTGATGCGATGCGCCCTCGAACAGTACTTCTCACATGAGAATGATGTTTCTTCAGGCCGAGTGA
AGAATCCAGAGTTCGTGGCAAAGGTCAAGGAGATACTCAAGGAAGATGACCGTCTCGTCGTGGGATGTCAGAGTGGAGCGAGGTCTCTATCTGCAACTGC
TGATCTTCTTAGTGCAGGCTTCAAACAGGCTTGCAATATGGGTGGAGGGTACCAAGCGTGGGAGAAGAATGGGTTTCAAGTGAAGAAACAACTGAAGCAA
GAAGAACTCTGA
AA sequence
>Lus10041895 pacid=23146703 polypeptide=Lus10041895 locus=Lus10041895.g ID=Lus10041895.BGIv1.0 annot-version=v1.0
MATVSLLRWNFLLLLLLLSVSRWVCYSSGAEVTTVDVHKAKSLLQSGHVYLDVRTEEEFKAAHPDAETIWKLRGQPEKETDDDVTKKKKIIYNIPYMFNT
SQGPRFRFCLIHLMRCALEQYFSHENDVSSGRVKNPEFVAKVKEILKEDDRLVVGCQSGARSLSATADLLSAGFKQACNMGGGYQAWEKNGFQVKKQLKQ
EEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66170 STR18 sulfurtransferase 18 (.1.2.3) Lus10041895 0 1
AT5G66170 STR18 sulfurtransferase 18 (.1.2.3) Lus10028442 1.7 0.9128
AT3G09760 RING/U-box superfamily protein... Lus10026501 2.8 0.9080
AT4G16820 PLA-I{beta]2 phospholipase A I beta 2, alph... Lus10000600 3.2 0.9165
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10014273 7.7 0.8788
AT5G14420 RGLG2 RING domain ligase2 (.1.2.3.4) Lus10000144 10.4 0.9170
AT5G66170 STR18 sulfurtransferase 18 (.1.2.3) Lus10041894 16.5 0.8854
AT2G26230 uricase / urate oxidase / nodu... Lus10008952 22.1 0.8941
AT3G56770 bHLH bHLH107 basic helix-loop-helix (bHLH) ... Lus10038306 26.4 0.8693
AT4G03420 Protein of unknown function (D... Lus10018572 30.5 0.8693
AT2G41640 Glycosyltransferase family 61 ... Lus10035441 35.5 0.8441

Lus10041895 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.