Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05950 77 / 7e-19 RmlC-like cupins superfamily protein (.1) AT4G14630 76 / 1e-18 GLP9 germin-like protein 9 (.1) AT5G38940 74 / 1e-17 RmlC-like cupins superfamily protein (.1) AT5G38930 73 / 2e-17 RmlC-like cupins superfamily protein (.1) AT5G39100 71 / 2e-17 GLP6 germin-like protein 6 (.1) AT5G38960 72 / 7e-17 RmlC-like cupins superfamily protein (.1) AT5G39150 72 / 7e-17 RmlC-like cupins superfamily protein (.1) AT5G39110 71 / 8e-17 RmlC-like cupins superfamily protein (.1) AT5G39120 71 / 9e-17 RmlC-like cupins superfamily protein (.1) AT5G38950 69 / 1e-16 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035186 [exp] 99 / 3e-27 AT5G39190 265 / 2e-90 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Lus10035185 [exp] 99 / 3e-27 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10032015 [exp] 98 / 6e-27 AT5G39160 262 / 3e-89 RmlC-like cupins superfamily protein (.1.2.3) Lus10032016 [exp] 98 / 6e-27 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10030049 [exp] 97 / 8e-27 AT5G39160 191 / 8e-62 RmlC-like cupins superfamily protein (.1.2.3) Lus10034254 [exp] 97 / 8e-27 AT5G39160 251 / 6e-85 RmlC-like cupins superfamily protein (.1.2.3) Lus10032017 [exp] 99 / 2e-26 AT3G05950 252 / 5e-84 RmlC-like cupins superfamily protein (.1) Lus10035278 [exp] 97 / 2e-26 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1) Lus10026962 [exp] 95 / 8e-26 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G163300 [exp] 90 / 7e-24 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163216 [exp] 90 / 8e-24 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163800 [exp] 84 / 1e-21 AT5G39130 255 / 1e-86 RmlC-like cupins superfamily protein (.1) Potri.011G162932 [exp] 83 / 2e-21 AT3G05950 268 / 1e-91 RmlC-like cupins superfamily protein (.1) Potri.011G163200 [exp] 83 / 2e-21 AT3G05950 266 / 5e-91 RmlC-like cupins superfamily protein (.1) Potri.001G465100 [exp] 82 / 8e-21 AT5G39160 253 / 8e-86 RmlC-like cupins superfamily protein (.1.2.3) Potri.013G052000 [exp] 80 / 5e-20 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1) Potri.013G052100 [exp] 80 / 6e-20 AT5G39110 285 / 2e-98 RmlC-like cupins superfamily protein (.1) Potri.013G051700 [exp] 78 / 2e-19 AT3G05950 298 / 2e-103 RmlC-like cupins superfamily protein (.1) Potri.013G051600 [exp] 78 / 2e-19 AT3G05950 296 / 1e-102 RmlC-like cupins superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041900 pacid=23146853 polypeptide=Lus10041900 locus=Lus10041900.g ID=Lus10041900.BGIv1.0 annot-version=v1.0 ATGAGGTTGATTCATTTCCAGCGTAATGTTGGGTACACAAATGCGGTAGCTATCGCTGAATTGAGCAGTCAAAACCCTGGAGTCATCACTATCGCTAACT CTGTCTTTGGATCGAAGCCTGATATCTCTAGCGACATCCTTGCCAAGGCTTTCCAAGTGTTGTGGAGCAGCTCCAAACTAAGTTCTAAGCAATACAAGGT CGATGTTTTGTTTCTCAATTCTTTTAATTTAAGGCCATGA
AA sequence Show only first row Show all	>Lus10041900 pacid=23146853 polypeptide=Lus10041900 locus=Lus10041900.g ID=Lus10041900.BGIv1.0 annot-version=v1.0 MRLIHFQRNVGYTNAVAIAELSSQNPGVITIANSVFGSKPDISSDILAKAFQVLWSSSKLSSKQYKVDVLFLNSFNLRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05950			RmlC-like cupins superfamily p...		Lus10041900 [exp]	0	1
AT3G16910		AAE7, ACN1	ACETATE NON-UTILIZING 1, acyl-...		Lus10016861 [exp]	1.7	0.8200
AT1G54140		TAF9, TAFII21	TBP-ASSOCIATED FACTOR 9, TATA ...		Lus10001863 [exp]	3.2	0.7823
AT2G24100		ASG1	ALTERED SEED GERMINATION 1, un...		Lus10024256 [exp]	3.5	0.7482
AT3G30210	MYB	ATMYB121	myb domain protein 121 (.1)		Lus10034372 [exp]	4.0	0.7622
AT3G01570			Oleosin family protein (.1)		Lus10003742 [exp]	7.5	0.7111
AT1G17930			Aminotransferase-like, plant m...		Lus10004830 [exp]	8.5	0.7769
AT2G19070		SHT	spermidine hydroxycinnamoyl tr...		Lus10005360 [exp]	8.5	0.6925
AT3G51810		AT3, GEA1, ATEM...	GUANINE NUCLEOTIDE EXCHANGE FA...		Lus10027816 [exp]	10.5	0.6715
AT5G15110			Pectate lyase family protein (...		Lus10033018 [exp]	11.6	0.7622
AT1G17800		AtENODL22	early nodulin-like protein 22 ...		Lus10020984 [exp]	19.9	0.6736

Compare expression of checked genes

Lus10041900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.