Lus10041906 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17880 133 / 3e-40 Chaperone DnaJ-domain superfamily protein (.1)
AT4G36040 133 / 3e-40 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
AT3G13310 82 / 4e-20 Chaperone DnaJ-domain superfamily protein (.1)
AT4G13830 76 / 8e-18 J20 DNAJ-like 20 (.1.2)
AT4G39960 66 / 4e-13 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT2G22360 64 / 2e-12 DNAJ heat shock family protein (.1)
AT3G17830 62 / 7e-12 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT4G37480 62 / 8e-12 Chaperone DnaJ-domain superfamily protein (.1)
AT5G06910 61 / 2e-11 ATJ6, EMB1393 J-domain protein 6 (.1)
AT1G80030 61 / 3e-11 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028453 214 / 3e-72 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1)
Lus10017263 109 / 9e-31 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10034484 100 / 4e-28 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10025060 89 / 1e-23 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10032957 84 / 3e-21 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1)
Lus10013558 78 / 1e-19 AT4G36040 82 / 1e-21 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10002355 76 / 3e-17 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2)
Lus10002356 71 / 2e-15 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2)
Lus10016637 71 / 2e-15 AT4G13830 187 / 3e-60 DNAJ-like 20 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G113100 152 / 5e-48 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1)
Potri.004G172300 123 / 1e-36 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.009G131800 117 / 8e-35 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020800 117 / 7e-34 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1)
Potri.005G240700 115 / 6e-33 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020700 114 / 1e-32 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1)
Potri.001G469600 86 / 1e-21 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1)
Potri.011G166500 82 / 6e-20 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.007G107600 77 / 2e-18 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1)
Potri.006G001301 75 / 1e-17 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Lus10041906 pacid=23146857 polypeptide=Lus10041906 locus=Lus10041906.g ID=Lus10041906.BGIv1.0 annot-version=v1.0
ATGATGCCCACAGCAGTTATTTCTCCTCCTCTTTCCCCAGTCTTCCAATTCTCCCCCAAATCCCCTTCCTCCGCCTCCGGCCGCCGCTCCCAATCGGGGC
CGCCTCCGATCTTCAATTCGGCGACCGCGTACAGGGAGAGACCCAGAGTCTCCATGCCTCCTCCGAGGATGCCTTCCTCCTCCTCCTCTCTGTACGAGAT
CCTAGGAATTCAGAGCGGCGCCTCCAGCCAGGAGATCAAATCGGCCTACAGGAAGCTCGCGAGGACTTGCCATCCAGATGTGGCCGCGATCGACCGCAAG
GACAACTCCGCTGACGAGTTCATGAGGATCCACGCCGCCTACACCACTCTCTCCGATCCCGAGAGGCGCGTCGTTTACGATCGGAAGCAGCTGTTCAGGC
GGATGCAGCCGCTGACCACCGCCGGATTGTCCGGGTACAGCGGCCGGAGCTGGGAGACCGATCAGTGCTGGTGA
AA sequence
>Lus10041906 pacid=23146857 polypeptide=Lus10041906 locus=Lus10041906.g ID=Lus10041906.BGIv1.0 annot-version=v1.0
MMPTAVISPPLSPVFQFSPKSPSSASGRRSQSGPPPIFNSATAYRERPRVSMPPPRMPSSSSSLYEILGIQSGASSQEIKSAYRKLARTCHPDVAAIDRK
DNSADEFMRIHAAYTTLSDPERRVVYDRKQLFRRMQPLTTAGLSGYSGRSWETDQCW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36040 J11 DnaJ11, Chaperone DnaJ-domain ... Lus10041906 0 1
AT2G17880 Chaperone DnaJ-domain superfam... Lus10028453 1.0 0.9497
AT4G28240 Wound-responsive family protei... Lus10033728 4.2 0.8631
AT1G03350 BSD domain-containing protein ... Lus10012761 8.8 0.8702
AT1G15670 Galactose oxidase/kelch repeat... Lus10013538 9.6 0.8559
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Lus10000076 9.7 0.9143
AT3G07870 F-box and associated interacti... Lus10006403 13.1 0.8625
AT1G10150 ATPP2-A10 Carbohydrate-binding protein (... Lus10018663 13.3 0.8865
AT3G15358 unknown protein Lus10011176 16.2 0.8562
AT2G27940 RING/U-box superfamily protein... Lus10016163 19.9 0.8460
AT5G27320 ATGID1C, GID1C GA INSENSITIVE DWARF1C, alpha/... Lus10002254 20.6 0.8847

Lus10041906 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.